SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017357 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017357
Domain Number 1 Region: 7-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000127
Family I set domains 0.089
Further Details:      
 
Domain Number 2 Region: 105-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000727
Family I set domains 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017357   Gene: ENSMGAG00000016489   Transcript: ENSMGAT00000018818
Sequence length 168
Comment pep:novel chromosome:UMD2:26:484211:502245:-1 gene:ENSMGAG00000016489 transcript:ENSMGAT00000018818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPGQASSFTQQPQDQVVIAGQPVTLLCAIPEYNGIVLWIKDGLALGVGRDLSSYPRYLV
VGDHLSGEHHLKILRADLQDDAVYECQAIQAAIRSRPARLTVLVPPDDPIIMGGPIISLR
AGDPLNLTCHADNAKPAASIIWMRKGEVVNGATYSKVRQRVLGTTCSS
Download sequence
Identical sequences G3UP67
ENSMGAP00000017357 ENSMGAP00000017357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]