SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017366 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017366
Domain Number 1 Region: 177-440
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-73
Family Protein kinases, catalytic subunit 0.0000000016
Further Details:      
 
Domain Number 2 Region: 73-209
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-34
Family SH2 domain 0.00000174
Further Details:      
 
Domain Number 3 Region: 9-95
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-17
Family SH3-domain 0.000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017366   Gene: ENSMGAG00000002394   Transcript: ENSMGAT00000020922
Sequence length 446
Comment pep:known_by_projection chromosome:UMD2:12:1711663:1715433:-1 gene:ENSMGAG00000002394 transcript:ENSMGAT00000020922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAVWPSGTECIAKYNFHGTAEQDLPFSKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANY
VQKREGVKAGIKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCEG
KVEHYRIIYSSSKLSIDEEVYFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQDEFS
RSGWALNMKDLKLLQIIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLR
HSNLVQLLGVIVEEKSGLYIVTEYMAKGSLVDYLRSRGRSVLGADCLLKFSLDVCEAMEY
LEANNFVHRDLAARNVLVSEDNIAKVSDFGLTKEASSTQDTXXXXXXXXXPEALREKKFS
TKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPAIVYEVMKKCWT
LDPGHRPSFHQLREQLVHIKEKELYL
Download sequence
Identical sequences G3UP76
ENSMGAP00000017366 ENSMGAP00000017366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]