SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017412 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017412
Domain Number 1 Region: 101-194
Classification Level Classification E-value
Superfamily Starch-binding domain-like 6.13e-22
Family Starch-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017412   Gene: ENSMGAG00000016740   Transcript: ENSMGAT00000018922
Sequence length 197
Comment pep:known_by_projection chromosome:UMD2:4:31792642:31793235:-1 gene:ENSMGAG00000016740 transcript:ENSMGAT00000018922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQGGESRPQAGQAGEGWCVMNLAGASGEVCKDRSEEQLCQPAENRDLDHEDWEVVSEHLD
WGEAGQNGSMEDSDSKEWEQGDCSDGDLKAKRVAAVPPMFQNIHVTFRVHYITHSAAQLI
GVTGDHECLGQWHSYVPLKYDKDGFWSESVTLPVDTKVEWKFILVENGKVTRWEECSNRT
LVTEHEDQIAHQWWGYH
Download sequence
Identical sequences G3UPB8
ENSMGAP00000017412 ENSMGAP00000017412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]