SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017439 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017439
Domain Number 1 Region: 258-525
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-82
Family Protein kinases, catalytic subunit 0.000000000609
Further Details:      
 
Domain Number 2 Region: 119-244
Classification Level Classification E-value
Superfamily SH2 domain 1.29e-38
Family SH2 domain 0.00000276
Further Details:      
 
Domain Number 3 Region: 57-150
Classification Level Classification E-value
Superfamily SH3-domain 1.13e-22
Family SH3-domain 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017439   Gene: ENSMGAG00000013415   Transcript: ENSMGAT00000018840
Sequence length 534
Comment pep:known_by_projection chromosome:UMD2:2:68355274:68392972:1 gene:ENSMGAG00000013415 transcript:ENSMGAT00000018840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEATKLTDERDGSLTQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHATGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSEKADGLCF
NLTVIATNNTPQTVGLAKDAWEVARDSLFLEQKLGQGCFAEVWRGTWNGNTKVAIKTLKP
GTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALK
LPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTAR
QGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGY
RMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences A0A087RKZ0 A0A091F166 A0A091H1W8 A0A091I3Y6 A0A091K999 A0A091LI31 A0A091NYS7 A0A091P1P0 A0A091PXV3 A0A091RJP2 A0A091UXD3 A0A091XK84 A0A093FDT6 A0A093K3W6 A0A093NVI5 A0A093QF57 A0A093R1I1 A0A099ZAA8 A0A0A0B2T4 A0A1V4JM46 A0A2I0MUC4 A0A2I0UQC0 F1NQU9 G3UPE4 H0ZP43 U3K8R9
59729.ENSTGUP00000012372 ENSMGAP00000017439 ENSFALP00000011423 ENSTGUP00000012372 ENSTGUP00000012372 XP_004174271.1.42559 XP_005030200.1.99704 XP_005043542.1.66865 XP_005244074.1.75256 XP_005418487.1.5688 XP_005445764.1.10750 XP_005510323.1.63277 XP_005518338.1.90289 XP_008493781.1.100939 XP_008635998.1.15636 XP_008929640.1.51550 XP_008929640.1.96775 XP_009077184.1.14518 XP_009287421.1.47732 XP_009324691.1.49731 XP_009461620.1.38621 XP_009484488.1.14425 XP_009505740.1.22320 XP_009680795.1.43253 XP_009808718.1.37116 XP_009891911.1.48241 XP_009912350.1.2804 XP_009936398.1.35112 XP_009950141.1.99599 XP_010006685.1.85724 XP_010081223.1.40768 XP_010132924.1.100080 XP_010188433.1.17318 XP_010205920.1.23224 XP_010215108.1.20684 XP_010401059.1.2935 XP_010559972.1.12557 XP_011593815.1.59079 XP_013031025.1.65836 XP_013225086.1.63277 XP_013804389.1.3284 XP_014734760.1.99236 XP_014820139.1.91963 XP_015139990.1.86415 XP_015477982.1.82291 XP_017684823.1.3805 XP_021248644.1.32913 XP_021411163.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]