SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017513 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017513
Domain Number 1 Region: 741-888
Classification Level Classification E-value
Superfamily Spectrin repeat 8.14e-39
Family Spectrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 203-358
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-36
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 102-251
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-36
Family Spectrin repeat 0.00047
Further Details:      
 
Domain Number 4 Region: 1717-1867
Classification Level Classification E-value
Superfamily Spectrin repeat 2.29e-35
Family Spectrin repeat 0.00000199
Further Details:      
 
Domain Number 5 Region: 1824-1979
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-34
Family Spectrin repeat 0.00000136
Further Details:      
 
Domain Number 6 Region: 521-673
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-34
Family Spectrin repeat 0.0000607
Further Details:      
 
Domain Number 7 Region: 1395-1547
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-33
Family Spectrin repeat 0.0000178
Further Details:      
 
Domain Number 8 Region: 1287-1429
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-33
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 9 Region: 309-461
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-31
Family Spectrin repeat 0.00073
Further Details:      
 
Domain Number 10 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 5.55e-31
Family Spectrin repeat 0.0000115
Further Details:      
 
Domain Number 11 Region: 1929-2084
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-29
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 12 Region: 1499-1654
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-27
Family Spectrin repeat 0.0002
Further Details:      
 
Domain Number 13 Region: 2091-2204
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 14 Region: 2314-2450
Classification Level Classification E-value
Superfamily EF-hand 6.27e-24
Family Calmodulin-like 0.0038
Further Details:      
 
Domain Number 15 Region: 2206-2321
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 16 Region: 967-1028
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 17 Region: 889-960
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 18 Region: 1060-1162
Classification Level Classification E-value
Superfamily Spectrin repeat 4.16e-19
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 19 Region: 472-539
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000216
Family Spectrin repeat 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017513   Gene: ENSMGAG00000004093   Transcript: ENSMGAT00000020282
Sequence length 2477
Comment pep:known_by_projection chromosome:UMD2:19:5277824:5353809:1 gene:ENSMGAG00000004093 transcript:ENSMGAT00000020282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSSLRRQKLEDSYRFQFFQRDADELEKWI
QEKLQIASDENYKDPSNLQGKLQKHQAFEAEVQANSGAIVKLDETGNQMINEGHFASETI
RTRLQELHRLWELLLEKMREKGVKLLQAQKLVQFLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDLAAHEERVNEVNQFAGKLIQEQHPEEELIKSKQDEVNASWQRL
KGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKGQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPINASQIQVKREELIASWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVKEKLTILSDERSALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MDDVATRRDALLSRRNALHERAMYRRAHLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYASDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDADNIKKKQEALVARYEALKDPMVARKQKL
ADSLRLQQLFRDIEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKIKLNELNQKWDSLKAKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIALRQEQIDNQTLITKEVGSVSLRMKQVEELYHSLLELG
EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTNEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVANDLESEGLMAEEVQAVEHQEVYGMMPRDETDSKTASPWKSARMMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLQEKCTELNQA
WSSLGKRADQRKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIKEKLDILDQERTDLEKAWVQRRMM
LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK
IAVLQSFADQLIAADHYAKGVIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQVNMILSKHQKHQAFEAELHANADRIRGVIDMGNS
LIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLS
EVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQV
KDKRETINGRFQRIKSMAAARRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRD
LTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKEL
KQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAF
ETDFTVHKDRVNDVCANGEDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDEN
SAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIAN
ITALKDQLLAAKHIQSKAIEARHASLMKRWNQLLANSAARKKKLLEAQEHFRKVEDLFLT
FAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDR
QIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHAN
AFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEA
LILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHF
DKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDTVDPNRDGHVSLQEYMAFM
ISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCISHMKPYMDGKGRE
LPSAYDYIEFTRSLFVN
Download sequence
Identical sequences G3UPL5
ENSMGAP00000017513 ENSMGAP00000017513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]