SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017534 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017534
Domain Number 1 Region: 4-40,186-406
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.95e-87
Family Bacterial dinuclear zinc exopeptidases 0.0032
Further Details:      
 
Domain Number 2 Region: 41-186
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 3.02e-36
Family Aminopeptidase/glucanase lid domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017534   Gene: ENSMGAG00000011310   Transcript: ENSMGAT00000019988
Sequence length 418
Comment pep:known_by_projection chromosome:UMD2:7:23553221:23558248:1 gene:ENSMGAG00000011310 transcript:ENSMGAT00000019988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPQYFVTRNYSTLIAFAVGGRFQPGNGFSLLGAHTDSPCLRVKRRSKRGQVGTVQVGVE
TYGGGIWNTWFDRDLTVAGRVIIKEPNTGHLEQRLVCVERPILRIPHLAIHLQRSINENF
GPNTEHHLVPILATAVQEELEKEPAMEHTASVAAAQTERHSPVLLSLLCSQLGVKPEQIV
ELELCLADTQPATLGGAFDEFIFSPRLDNLHSCYCALQALIDSCTVPSLSQEPXXXXXXX
WSSWQVGSESAQGAESLLTELVLRRISASPQNLTAFEEAVAKSYMISADMAHAVHPNYVD
KHEENHRPAFHKGPVIKVNSNQRYASTAVTEAVIRDIAARVGVPLQEFMVRNDTPCGTTI
GPILASRLGLRVLDIGCPQLAMHSIREMCCTSGVLQSITLFKGFFELLPVVSSSLVVD
Download sequence
Identical sequences G3UPN3
ENSMGAP00000017534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]