SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017584 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017584
Domain Number 1 Region: 315-536
Classification Level Classification E-value
Superfamily Caspase-like 4.78e-35
Family Caspase catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 5-111
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000165
Family DEATH domain, DD 0.011
Further Details:      
 
Domain Number 3 Region: 217-276
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000151
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 107-188
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000531
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017584   Gene: ENSMGAG00000000932   Transcript: ENSMGAT00000019367
Sequence length 703
Comment pep:novel chromosome:UMD2:30:773792:778408:-1 gene:ENSMGAG00000000932 transcript:ENSMGAT00000019367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDWSLPISSLGEEVVAQLCELLDTASRGWRKLAEVAGAEKRFKCSEEELEMCSLKVLEP
LGSPTQSLLQLLAERECSLRYLRGCLHRMHTQACQLLNCAVHDVIRITVQPESQVVAEGT
RVSLTCWASGPPGLTYQWFCGKQEVPGATAPELMVDTAAPPGLPQWYICRVSCGAAFAFS
RWAHIQVERSHSPISQRLLPQHGGSADPAAATAVPPGGDPLVLECRALGNPPPQYQWFRN
RRPVEGARGPRLQVQLVTTAERGTYSCRVFNLFHELWSQEVDVEIGPRLFASGAPWQEGD
GDSPEPGSPDQLYATDKVALLVGNMHYTHHKDLRAPMVDVHALSALLRQLDFKVVSLLDL
RRDEMQMAVDEFLLLLDKGVYGLLYYAGHGYENFGTSFMVPIDAPGSYTSAHCLCVQHVL
QRMQQRRTGLNIFLLDMCRKRNLNDDVLPQVGALEVTANIVFGYATCADAEAYELSQGEL
SNGVFVTFLKRWLLEDEKITVLLDKVAEDMGTLELTRGRQALELRSNLSERRALTDPIRS
LGRAETSARNLQWAKAHVLPESRHLRFDCGVTVQLGFAAEFSNIMIIYTRILATPGDITE
CVAKLTDLPEELDVDLKYTNRESPEELGSPLVPTWSLTCPSCCLYSRLCGLQRLRQELTF
TVCLQFRYRGVADFVEERRAVSVGRPLIAKLNLSPRDPGTPPA
Download sequence
Identical sequences G3UPT1
ENSMGAP00000017584 ENSMGAP00000017584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]