SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017615 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017615
Domain Number 1 Region: 256-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-80
Family Protein kinases, catalytic subunit 0.000000000314
Further Details:      
 
Domain Number 2 Region: 118-246
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-38
Family SH2 domain 0.00000148
Further Details:      
 
Domain Number 3 Region: 76-139
Classification Level Classification E-value
Superfamily SH3-domain 6.93e-19
Family SH3-domain 0.0000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017615   Gene: ENSMGAG00000003468   Transcript: ENSMGAT00000019718
Sequence length 527
Comment pep:known_by_projection chromosome:UMD2:22:5317652:5324924:1 gene:ENSMGAG00000003468 transcript:ENSMGAT00000019718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSKSKPKDPSQRRRSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKL
FGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWL
AHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETT
KGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFGSLQQLVAYYSKHADGLCHR
LTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGKDSSGPGTWNGTTRVA
IKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGE
MGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIED
NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLD
QVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFDHLQAQLLPAC
Download sequence
Identical sequences G3UPV9
ENSMGAP00000017615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]