SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017638 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017638
Domain Number 1 Region: 95-361
Classification Level Classification E-value
Superfamily Caspase-like 4.93e-87
Family Caspase catalytic domain 0.0000000248
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000518
Family Caspase recruitment domain, CARD 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017638   Gene: ENSMGAG00000005586   Transcript: ENSMGAT00000019091
Sequence length 364
Comment pep:known_by_projection chromosome:UMD2:23:5115017:5120040:1 gene:ENSMGAG00000005586 transcript:ENSMGAT00000019091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGTRREQARQLVIDLETRGKQAFPIFLSILRETGHDDLADMLDEGCGSPISPPVDLRPVQ
LELPGERRDKSLRDESQTLLLVCGGVGRGSAVDKSDHRLVYQLRADPCGHCLIFNNVNFS
RDSDLSARAGSDIDCEKLEKRFKSLCFHVRTLRNLKAQEIDLELRKLARLDHSTLDCCLV
VILSHGCQTSHIQFPGGIYGTDGKTIPIEKIVNYFNGSQCPSLRGKPKLFFIQACGGEQK
DQGFEVGCESPQDETCRGSVESDAIPFQAPSGSVDEPDAVASLPTPGDILVSYSTFPGFV
SWRDKVSGSWYVETLDDVLEHYARSEDLLTMLLRVSDIVSTKGKYKQIPGCFNFLRKKFF
FLCK
Download sequence
Identical sequences G3UPX8
ENSMGAP00000017638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]