SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017704 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017704
Domain Number 1 Region: 120-441
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-89
Family Protein kinases, catalytic subunit 0.0000000659
Further Details:      
 
Domain Number 2 Region: 19-62
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000703
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017704   Gene: ENSMGAG00000010216   Transcript: ENSMGAT00000020701
Sequence length 464
Comment pep:known_by_projection chromosome:UMD2:11:19912456:19924209:-1 gene:ENSMGAG00000010216 transcript:ENSMGAT00000020701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCFLVYQNGLACLAQEKIRAHCAICSDRIWGLGRQGYKCINCKLLVHKKCHKLVNSECGR
HTLQPEPIMPMDPSSVHPDNVESVIPYNPSSHESLDHVGEEKEAMGIRESGKASSSLGLQ
DFDLLRVIGRGSYAKVLLVRLKKTERIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNH
PFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHER
GIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGF
SVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAAGV
LKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDLMEQKQVVPPFKPNISGEFGLDNF
DSQFTNEPVQLTPDDDDIVKKIDQSEFEGFEYINPLLMSAEECV
Download sequence
Identical sequences G3UQ38
ENSMGAP00000017704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]