SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017731 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017731
Domain Number 1 Region: 186-295
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000183
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017731   Gene: ENSMGAG00000017059   Transcript: ENSMGAT00000020332
Sequence length 1426
Comment pep:novel chromosome:UMD2:5:36295240:36399446:1 gene:ENSMGAG00000017059 transcript:ENSMGAT00000020332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKNDGVNTPLAEVQLCYLEAQRDAVEQMSLKLYSEQYNSSSKRKEEFADMSKVHTVGSNG
LLDFDSEYQELWDWLIDMESIVMDSHDLMMSEEQQQHLYKKYQAAVNLPHLVKAENFLTS
VSNLKLGFIVLQQNVLLNTVQNMNLKSCKWNKLGEKTLGEKIQDTMVGHSGLGPRDLLSP
ESGSLVRQLEVRIKELKGWLRDTELFIFNSCLRQENEGTMNAEKQLQYFKSLCCEIKQRR
RGVASVLRLCQHLLDDQETCNLSADHQSMQLIIVNLERRWEAIVMQAVQWQTRLQKRLEK
DPESLNFIDPSLMDLNGPSEDALEWDETDISNKLISVNEDLSDPDQELKKDDLSQKPTSG
ECGSNDVNEDESISDRGSPLYCSSITSPPNPHIYQVYSLHNIELSEKKHMPFLKKTSKLS
SVTQSNILNKSLSKDSSFSSTKSLPDLIGGTMLAKPYNYMYQSGNISRHSESESGIVSEC
DTETTNNSEIFLLNDIESTQSNPEIGHTGTQMDDIIDVIKQKTKQDEEDHASLSDDFQLA
PSGGCGNEIDRDLNNITMCKTVCLEELQGKQDVFTFYDYSYLQGSKFKLPVIMKQSQTEK
TQTEGALFRGFCFDKIPGKSEHKPGESQPDEFIHDHNLANIPGGSDPNSSKSVETVRKLI
ATENTRQISALSHSSSLESLSVVGDLFSSGIFKSGDGLQRSTSLESWLTSYKSNEDLFSH
HGSGDISASSDSVGELSKRTLDLLNRLENIQSPLEQKIKRSISDITLQSSSQKMSFTGQL
SVDIASSVNEDSAASLTELSSSEDLSLCSEDIVLHRNKIPDSNASFRKHLNRSVADESDV
NVSMIVNVSCTSACTDDEDDSDLLSSSTLTLTEEELGIKDEDDDSSIATDEDIYEECNLI
SGLDYIKNELQTWMRPKFSLTREKRKSNLSDEIQHSKVSNETSKATDTLNIEALLNGSVQ
KITENNGNSKNVSRNHEKGTKGHLMKDISQVVKDQLVDDMENGNVENTLGSHKGDLVRTS
ATSKIHASLGVKEAENEFCVCEAFTDSSDDSHMDGKETVLLSVGSRNPPKECQSHLQSDY
HCIAFSPAKKPCLESSSKTSSVDTQAASFQTSLSDDQQHKISIAEKSTDCCAVLKSSKTE
CDSSANGPDLCCNCDSAAFDKRNMEDGSVHNFVKEIIDMASTALKSKSQPECESSAPASL
TQIKEKVLEHSHRPIELRKGDFYSYLSLSSHDSDCGEVIKYIEEKSSTPVPLDFTDERDN
IECFFEACPEDERVEQQQSICNGTPEARESPDELTLAPLGKVKTSLEDSNLSFLCDDDNI
NASNPNKENASNNLKNAVDDLLISDWQTEGLEKNFPELSSTKSSIGKSPVTEEPKECVAA
SEEASEFHLKHDHSQNEEVLHQNTKTLTCEENLLNLRKERRFNMRR
Download sequence
Identical sequences G3UQ64
ENSMGAP00000017731 ENSMGAP00000017731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]