SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017740 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017740
Domain Number 1 Region: 856-998
Classification Level Classification E-value
Superfamily PH domain-like 3.16e-17
Family GRAM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017740   Gene: ENSMGAG00000006056   Transcript: ENSMGAT00000019520
Sequence length 1066
Comment pep:novel chromosome:UMD2:5:8730399:8880560:1 gene:ENSMGAG00000006056 transcript:ENSMGAT00000019520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGPAEGLGKIIQRFPQKDWEDTPFPQGIELFCQPGGWQLSKERKQPTFFVVVLTDIDSE
RHYCSCLTFYEAEINLQGTKETEGEEESGLIAPAEVFAPKSLVLVSRLDYPEIFRACLGL
IYTVYVDSLNVSLEALIANLCSCLVPASGGSQKLFSLGAGDRQLIQTPLHDSLPVTGTSV
ALLFQQLGIQNVLSLFCAVLTENKVLFHSASFQRLSDACRALESLMFPLKYSYPYIPILP
AQLLEVLSSPTPFIIGVHSVFRNDIHELLDVIIADLDGGTIKIPECIHLSQLPEPLLHQT
QMALSLVLHPDLETADYAFPPPRTALSHTKMLDKEVRAIFLRLFAQLFQGYRSCLQLIRI
HAEPVIHFHKAAFLGQRGLIENDFLTKVLNGMAFAGFVSERGPPFRACDLFDEXVAFEVE
RIKADEGNPPKMIKHVRELAEQLFKNENPNPHIAFQKVPRPTEGSHLRVHILPFPRINEC
RVQELLQEGLARSQGAPTATRGDKKCVVPAGPPVVSIMEKGSTVFNSAQRLEVVRNCISF
IFENKFLETEKTLPAALRALKGKAARHCLTQELGLHVKQNRAILDHQQFDYIVRMMNCAL
QDCSSSEEYSVAAALLPLTTAFYRKLAPGVSQFAYTCVQDHPIWTNQQFWETTFYSNVQN
QVRSLYLTAKEDNHAVQPRQKEKNSVSPDHDKTAMDLAAEQLRLWPTLNKQTQQELVQNE
ESTVFSQAIHFANLMVYLLVPLDTSKNKLLRASATGDWESGSNSIVTNSIAGSVAESYDT
ESGFEDSENNDVANAVVRFITRFIDKVCTESGVTQDHIKGLHCMIPGIVAMHIETLEAVH
RESRRLPPIQKPKILRPTLLPGEEFVCEGLRVLLDPDGREEATGGLLGGPHILPAEGALF
LTTYRIIFKGTPHDQLVGEQTVIRSFPIASVTKEKKITIQNQLQQSMQEGLQITSATFQL
IKVAFDEEVSPEVVEIFKKQLMKFRYPQSIFSTFAFAAGQTAPQIILPKQKEKNTSFRTF
SKSIVKGAKRAGKMTIGRQYLLKKKTSTIMEERGNRPGWNEDDDVS
Download sequence
Identical sequences G3UQ72
ENSMGAP00000017740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]