SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017761 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017761
Domain Number 1 Region: 395-609
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-54
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017761   Gene: ENSMGAG00000017386   Transcript: ENSMGAT00000019694
Sequence length 730
Comment pep:novel chromosome:UMD2:2:95486766:95516156:-1 gene:ENSMGAG00000017386 transcript:ENSMGAT00000019694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQMGTIAPILEREPKAVGTNDEEEDEGEQFDFDSGDEIPEADRQAFVPPPPEPGSNTEHH
EANVTECPSTKGADSLEKSEKLQASESTAEDTPRKVNPYSVINISPMQEKDPSSSPDPSP
QDEPASPNTSSGYSVPVPCGYAVPSNLPLILPAYSSPVIIRSVSVDEEGMQSATEECHCN
SLNSEEPQNSEDNQDKREDDALAKWVADPANTAWMENPDEVIYDDVPRENSDSEPEEMIY
DDVENGDDGGNSSLEYGWSSSEFESYEEQSDSECKNGIPSSFLRGNHKRHLSHDLTRLKE
HYEKKMKDLMANTVGAVEIQQLKQKHELKMQKLMRAAREGTKDGLEKTKAAVKKGRSFIR
TKSFISQDHRSSCLEEEELNLFIDVDCVHTEAIMTPMPEGLSQQQVVRRYILGSVVDSEK
NYVDALKRILEQYEKPLSEMEPKLLSERKLKMVFYRIKEILQCHSMFQIALASRVSEWDS
VEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVGILKKTCATKPAFLDFLKQCQESSPDRI
TLYGLMMKPIQRFPQFILLLQDMLKNTNKGHPDRLPLQMALTELETLAEKLNERKRDADQ
RCEIKQIAKAMNERYLNKLLSSGNRYLIRTDDMVETVYNDKGEIIKTKERRLFMLNDVLM
CATVNVRTSYESSGTVTTGQRYLLKWSVPLGQVEVIEYGSSEGQGENCRFPPQHSAENVI
VNSKPSKIYI
Download sequence
Identical sequences G3UQ91
ENSMGAP00000017761 ENSMGAP00000017761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]