SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017790 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017790
Domain Number 1 Region: 261-475
Classification Level Classification E-value
Superfamily Caspase-like 1.3e-33
Family Caspase catalytic domain 0.019
Further Details:      
 
Domain Number 2 Region: 60-143
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000182
Family I set domains 0.032
Further Details:      
 
Domain Number 3 Region: 3-62
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000785
Family DEATH domain, DD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017790   Gene: ENSMGAG00000001082   Transcript: ENSMGAT00000019428
Sequence length 639
Comment pep:known_by_projection chromosome:UMD2:Z:793207:821443:1 gene:ENSMGAG00000001082 transcript:ENSMGAT00000019428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSPLDLEQCSLKVLEPEGSPSWSLLKLLGDRGCTVVELVEFLQAMEHTEALQCLSYSGHY
SIKIVVQPDSQAVLCGQVVKLCCWATGHPFVHYQWFKQKKEVPHGNSPELVLNPVKVNDA
GFYICRVNSESSFTFSRWARLEVLSFKNSVSASQLIVQXSTVADTLSRTLSKPIKPPSKI
KEKMRGKKVRQQKWKKNQTTFFMSSQQQIQIRGSWFQNLQLLSHSLKVKSLFSFLANRGE
NWTAGMGESCEKINPYKLVATDKVALLIGNMSYWNHPQLKAPMVDVYELTNLLRQLDFKV
VSLLDLTESEMRNAVDEFLLLLDRGVYGLLYYAGHGYENYGNSFMVPIDAPNPYRSANCL
CVQNILKLMQEKETGLNVFLLDMCRKRNEYDDTILILDALKVTANIVFGYATCQGAEAFE
IQQLGLANGIFMKFLKERLLEDKKITVLLDEVAEGELQLTAGCSLAAVFGFSFTKLPVLK
LTVLNQGALDKDSSQLQWREIIESPTGSTYKWEVCNAGSANNYLSLCYTSFFLIFVQLAR
PQSTQICLIKLTKSMKRCNISIKITAAEVLSKLTAPLQCSWSTTCCTCILFSLLSDTKFL
KEHLIFTVCLHYEYPGIEDTMDERKEVNVGKPLIAKLGL
Download sequence
Identical sequences G3UQB5
ENSMGAP00000017790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]