SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017792 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017792
Domain Number 1 Region: 79-142
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000103
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017792   Gene: ENSMGAG00000016563   Transcript: ENSMGAT00000019757
Sequence length 142
Comment pep:known_by_projection chromosome:UMD2:8:37292010:37302721:-1 gene:ENSMGAG00000016563 transcript:ENSMGAT00000019757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRA
RRLDPSEGTAPSYLENATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSE
LITPHAIRVQTPPRHIPGVVEV
Download sequence
Identical sequences G3UQB7
ENSMGAP00000017792 ENSMGAP00000017792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]