SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017798 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017798
Domain Number 1 Region: 191-261
Classification Level Classification E-value
Superfamily EF-hand 3.72e-19
Family EF-hand modules in multidomain proteins 0.00028
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000012
Family Spectrin repeat 0.00000458
Further Details:      
 
Domain Number 3 Region: 94-188
Classification Level Classification E-value
Superfamily EF-hand 0.00000000015
Family Calbindin D9K 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017798   Gene: ENSMGAG00000011723   Transcript: ENSMGAT00000019986
Sequence length 262
Comment pep:known_by_projection chromosome:UMD2:2:38309279:38402881:-1 gene:ENSMGAG00000011723 transcript:ENSMGAT00000019986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEIARSSIEMTGPLEDQMNQLKQYEQNIINYKHNIDKLEGDHQLIQEALVFDNKHTNYT
MEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNDFRASFNHFDRHKTTDVSRF
RKLIAVIYKLTDESDNLHSDEFKACLISLGQVGNDLQGEAEFARIMSLVDPNGQGTVTFQ
SFIDFMTRETADTDTAEQVIASFRILASDKPYILADELRRELPPEQAQYCIKRMPQYTGP
GSVPGALDYTSFSSALYGESDL
Download sequence
Identical sequences G3UQC1
ENSMGAP00000017798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]