SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018006 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018006
Domain Number 1 Region: 68-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000019
Family LIM domain 0.00069
Further Details:      
 
Domain Number 2 Region: 34-66
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000041
Family LIM domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018006   Gene: ENSMGAG00000001735   Transcript: ENSMGAT00000019339
Sequence length 149
Comment pep:known_by_projection chromosome:UMD2:29:2134473:2138364:-1 gene:ENSMGAG00000001735 transcript:ENSMGAT00000019339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQASEAASTTPSHEAKSNSGGSTVQRSKSFSLKAQVKEMCTACQKTVYPMERLVADKFV
FHNSCFCCKHCHAKLSLGSYAALHGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWVHKE
VAGPSRHEQGMAHPSLEPSRQHGAVLSQC
Download sequence
Identical sequences G3UQR5
ENSMGAP00000018006 ENSMGAP00000018006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]