SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018062 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018062
Domain Number 1 Region: 32-238,412-498
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.54e-62
Family Bacterial dinuclear zinc exopeptidases 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018062   Gene: ENSMGAG00000008157   Transcript: ENSMGAT00000020848
Sequence length 502
Comment pep:known_by_projection chromosome:UMD2:3:41311170:41325452:-1 gene:ENSMGAG00000008157 transcript:ENSMGAT00000020848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HFRSRIFYLFLWLFLCVLRFLSHCSHKMAALDTLFKYIDEHQDLYVKRLAEWVAIQSVSA
WPEKRAEIRRMMEVAAKDIERLGGTAQLMDIGTQKLPDGSEIPLPPIILGKLGSDPHKKT
VCVYGHLDVQPAALEDGWDSEPFTLVERDGKLYGRGSTDDKGPVLAWLNALEAYQKTNQE
FPVNIKFCLEGMEESGSEGLDELIFAQRNAFFKDVDYICISDNYWLGKNKPCITYGLRGI
CYYFIEVECSDKDLHSGVYGGSIHEAMTDLIALMGSLIDKKGKILIPGINEAVASVTGEE
LAIYEKIDFDLEEYAKDVGATKLLHDTKRDILMHRWRYPSLSLHGIEGAFSASGAKTVIP
RKVIGKFSIRLVPNMTPEEVTKHVKDYLSKQFAELQSPNKFKVYLGHGGKPWVSDFDHPH
YMAGRRAMKTVFGVEPDLTREGGSIPVTLTFQEATGKNVMLLPVGAADDGAHSQNEKLNR
YNYIQGVKMLGAYLYEVSQTSM
Download sequence
Identical sequences G3UQW6
ENSMGAP00000018062 ENSMGAP00000018062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]