SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018125 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018125
Domain Number 1 Region: 329-417
Classification Level Classification E-value
Superfamily DEATH domain 2.62e-22
Family DEATH domain, DD 0.00019
Further Details:      
 
Domain Number 2 Region: 118-158
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000326
Family TNF receptor-like 0.00064
Further Details:      
 
Domain Number 3 Region: 58-115
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000801
Family TNF receptor-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018125   Gene: ENSMGAG00000014258   Transcript: ENSMGAT00000018384
Sequence length 427
Comment pep:known_by_projection chromosome:UMD2:1:83088245:83101621:1 gene:ENSMGAG00000014258 transcript:ENSMGAT00000018384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLALPRSSLGMVILTFACVLMDESEGIPPVPYMLQLRRVTLDRRGPFNILRREKRQVQ
CQLGQYLHPKRTHCCMRCHAGTYKAKDCKWPDQAPVCLPCPNGTFTAVDNIMKKCYQCTR
CRTELQQIEETPCTLKQDTVCGCRKNQYQFGQTDFFQCKNCSPCVNGVIANCSKDRDAIC
RCKPMFFLTLNNVCKHCNSCVGEECLQCNSPVTTSPNSSELNGNLVLGIIVAVIVVICVL
YIVNKTVKLVQKNGIAASFYSCVSLPQTSKEPVSEVEAKGSAIAVLPEIQKEKELLVNAT
PPSVPLLQSSHELPDCVRPARKRQLPDNPAILYTVVDHVPPSRWKEFVRRLGLTDYDLER
IEMEHRRLRDAQYEMVRLWKLQMGHAATVEHISCVLNQMELSGCSEAIQEALLNQNSHQP
CSFHSHL
Download sequence
Identical sequences G3UR26
ENSMGAP00000018125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]