SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018186 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018186
Domain Number 1 Region: 19-134
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 2 Region: 96-243
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000101
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018186   Gene: ENSMGAG00000017413   Transcript: ENSMGAT00000019229
Sequence length 383
Comment pep:novel chromosome:UMD2:2:50472335:50484960:-1 gene:ENSMGAG00000017413 transcript:ENSMGAT00000019229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVIDRWELIQAQALSKELRMKQNLQQWQQFNSDLNSIWAWLGETEEELEKLRRLDLSTDI
QTIELRIRKLKELQKAIDNRKAIILSINLCSSEFTQSDSEEKQKKLQERLSQMNICWDHV
CSMIEEWRCSLQDALMQCQDFHEMSHGLLLWLENIDRRKNEIVPINPNLDSEILQDHHRL
LMQIRRELLESQLKVASLQDMSCQLLVNAEGKDCLEAKEKVHVIGNRLKLLLKEVIRHIK
DLEKALDISSSQLDLSSWSSADELDTSGSVSPVSGQSTPSRQRTPRGKCSLSQPGPSVSS
PHSRSIRDGSGSSPSEAGPAWQHPSFFLRVLRAALPLQLLLLLLIGLACLVPMTEEDYSC
TMANNFARSFHPMLKYMNGPPPL
Download sequence
Identical sequences G3UR84
ENSMGAP00000018186 ENSMGAP00000018186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]