SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018266 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018266
Domain Number 1 Region: 105-299
Classification Level Classification E-value
Superfamily PA domain 2.62e-68
Family PA domain 0.0000000342
Further Details:      
 
Domain Number 2 Region: 51-111
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0000157
Family FolH catalytic domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018266   Gene: ENSMGAG00000015216   Transcript: ENSMGAT00000018952
Sequence length 312
Comment pep:novel chromosome:UMD2:1:195564318:195572391:1 gene:ENSMGAG00000015216 transcript:ENSMGAT00000018952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSRATLCTWLGCLALLGCFVLGFLIGWFKKPTEKNPNSSDVCQNVRQKLVDEMKAESI
KRFLRSFTELPHLAGTEQNFLLAKQIQGQWKEFGLDSAELVHYDVLLSYPSETQPNYISV
IDDQGNEIFNTSSFEPPPQGYENVTDILPPYNAFSAQGTPEADLVYVNYGRTEDFFKLER
EMGINCTGKIVIARYGKIFRGNKVKNAILAGAIGIILYSDPADYCAPGVDPYPDGWNLPG
RGVQRGNVLNLNGAGDPLTPGYPAKEYTFRYKVNEGVGIPKIPVHPIGYHDAEVLLHYLY
LLLFCSSMCFRN
Download sequence
Identical sequences G3URF9
ENSMGAP00000018266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]