SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018296 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018296
Domain Number 1 Region: 49-260
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.04e-81
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000362
Further Details:      
 
Domain Number 2 Region: 544-761
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.98e-61
Family Ankyrin repeat 0.0000245
Further Details:      
 
Domain Number 3 Region: 256-386
Classification Level Classification E-value
Superfamily E set domains 5.37e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000121
Further Details:      
 
Domain Number 4 Region: 810-892
Classification Level Classification E-value
Superfamily DEATH domain 1.21e-17
Family DEATH domain, DD 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018296   Gene: ENSMGAG00000011299   Transcript: ENSMGAT00000019111
Sequence length 986
Comment pep:known_by_projection chromosome:UMD2:4:43102647:43149745:1 gene:ENSMGAG00000011299 transcript:ENSMGAT00000019111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLKMAGEDPYIMGVSDPQMFAMDQLMGMNTIFNNTGYITSDLPLRTADGPYLQIIEQPKQ
RGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKYVHLHAHS
LVGKFCEDGVCTVNAGPKDMVVGFANLGILHVTKKKVFETLETRMIDACKKGYNPGLLVH
PELGYLQAEGCGDRQLTEREREIIRQAAVQQTKEMDLSVVRLMFTAFLPDSNGGFTRRLD
PVISDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEDENGG
MWEGFGDFSPTDVHRQFAIVFKTPKYRDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
IKDKEEVQRKRQKLMPNFSDGYGGGSGAGGGGMFGGGGGGAGSGFSYPSYGYSAFGGMHF
HPGTTKSNAGMKHEELSNSTVEKDEESSDKQSGQWDMKHNVKVETVEKNECRTSGHYEEK
EDAALCCKDEGNKAKCGCQDGLFLEKAMQLAKRHCNALFDYAVTGDVRMLLAVQRHLTAV
QDDNGDNVLHLSIIHLHRKLVKNLLEVMPDMNYNNIINMRNDLYQTPLHLAVITKQAEVV
EDLLKAGANVNLLDRHGNSVLHLAAAEGDDKILSLLLKHQKASSMIDLFNGEGLSAVHMV
VIANSLSCLKLLIAAGVNVNAQEQKSGRTALHLAVEQENIPLAGCLLLEGDADVDSTTYD
GTTPLHIAAGRGFTKLAAVLKAAGADPHVENFEPLFDVEEDVKGDDDEGIVPGTTPLDMA
ANWEVYDILNGKPYIAAAAVSEDLLTQGPLRELNENSKKQLYKLLETPDPSKNWSTLAEK
LGLGILNNAFRLSPSPSKTLLDNYKISGGTVQELIAALRQMDHTEAIEVIQKALWSSQSQ
SHQEDNTIETFPSSSPANFAKGETGELYNHKFQDTESTCDSGVETSFRKLSFTYSDSLNS
KSSVTLSKMTLGYRKAQCKAIIYLTR
Download sequence
Identical sequences G3URI9
ENSMGAP00000018296 ENSMGAP00000018296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]