SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018353 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018353
Domain Number 1 Region: 62-284
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-65
Family DBL homology domain (DH-domain) 0.0000000029
Further Details:      
 
Domain Number 2 Region: 284-425
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-31
Family Pleckstrin-homology domain (PH domain) 0.000000217
Further Details:      
 
Domain Number 3 Region: 439-559
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.4e-26
Family PLC-like (P variant) 0.0088
Further Details:      
 
Domain Number 4 Region: 2-63
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-25
Family SH3-domain 0.0000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018353   Gene: ENSMGAG00000016762   Transcript: ENSMGAT00000019723
Sequence length 566
Comment pep:novel chromosome:UMD2:1:111239146:111260118:-1 gene:ENSMGAG00000016762 transcript:ENSMGAT00000019723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQVGLFPSNYVKLTTDTD
PSQQWCADLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLMESELLTEK
EVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILTAQLPHMQPYIRFCSCQ
LNGAALIQQKTDEVPEFKEFVKRLAMDPRCKGMPLSSFLLKPMQRVTRYPLIIKNIIENT
PENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTN
CLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQIIKPLGSSGTDKVFSPKSNLQYKMY
KTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERRTAWVQKIKAASELYIE
TEKKKREKAYLVRSQRATGIGRLMVNIVEGIELKPCRSHGKSNPYCEVTMGSQCHITKTM
QDTLNPKWNSNCQFFIKDLEQDVLCITVFERDQFSPDDFLGRTEIRVADIKKDQGSKGPV
TKCLLLHEVPTGEIVVRLDLQLFDEP
Download sequence
Identical sequences G3URP1
ENSMGAP00000018353 ENSMGAP00000018353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]