SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018375 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018375
Domain Number 1 Region: 562-662
Classification Level Classification E-value
Superfamily DEATH domain 1.56e-21
Family DEATH domain, DD 0.0096
Further Details:      
 
Domain Number 2 Region: 4-46
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 0.00000000248
Family Outer arm dynein light chain 1 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018375   Gene: ENSMGAG00000009084   Transcript: ENSMGAT00000020487
Sequence length 669
Comment pep:known_by_projection chromosome:UMD2:5:15894388:15904077:1 gene:ENSMGAG00000009084 transcript:ENSMGAT00000020487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGNLKSLRRLHLHSNLLVTVPASLASLPNLSRLDLQSNLLRAVPPEIQTAPFVHLRGNP
XASASVGLPSCSLAHESSATELRRLFLAPEEDRSFTVTSEGCEVFLACGIRFYFPPEAAS
DSLRIHFRTLAPDPRWVKLRHHDVLLSKVLELQPHGVKFQQEVEIWMPYASPETLHKREV
VVRTFSGQSWSDLRTQVEKRRSKKDVARCSVLHFSWFLVVSRLVQNECKVSTEGTLLFSS
VDPNIKVTFPPGVTEETRSVKLQVLPVSAEEIAELTADAECKASPLLCLSQDSLVDFLTP
VRIQLPLPLGVTGSNLDWSRLHLLCGDVEGQTWDDITNEVMLELTHLCAVFEVTHFSCSF
SLPSTFFTLNLSSLKSSLYPSPSAYWLWYTTKTYIGGIARKVYERLRMYQVNFIALQRKK
DPEQVLLQCLPKHKVDPVLKKLQDRYRGPEPSDMVEMFEGEQFFAAFERGISIDMDRPDC
VDGRLSFIFYSHLKNMKEIYVSFYRGAVPESIPEDASRRRRGPDSLWLATLPIKLPRLKP
RWGETSSSSNGFSFPPLNLGNAETGYLTQANLLSIARRVGADWQTIGLNLGLTYQQIERI
GYNNREDLDKQILDMLFSWAQQNSEDPDCVSKLIRAMKESGRQDIADEVETIIELGRQKY
RESIRRVGL
Download sequence
Identical sequences G3URR2
ENSMGAP00000018375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]