SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018589 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018589
Domain Number 1 Region: 118-272
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 1.31e-53
Family Transferrin receptor-like dimerisation domain 0.000000541
Further Details:      
 
Domain Number 2 Region: 7-116
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0000000000000157
Family FolH catalytic domain-like 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018589   Gene: ENSMGAG00000016460   Transcript: ENSMGAT00000020688
Sequence length 273
Comment pep:novel chromosome:UMD2:1:195584520:195594214:1 gene:ENSMGAG00000016460 transcript:ENSMGAT00000020688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPLQISSPDEGYENKSLYESWLEKDPAPENNSYPRINKLGSGSDFEAYFQRLGIASGRVR
YTKNRKTDKFSNYPVYHTVYETFELVEKFYDPTFTKQLAIAKLRGKLVYELADSQVIPFD
CRDYGESLKGYSDRIYKLAKKHEEQLETYRVSFDPLFSAVGNFSEAAAEFHRRLEQVDRK
DPVAVRIMNDQLMFIERAFIDPLGLPGRKFYRHVIFAPSSHNKYAGESFPGIYDAMFDIE
SKTDHQGAWEEVKRQISIAAFTVQAAAETLKEV
Download sequence
Identical sequences G3USB7
ENSMGAP00000018589 ENSMGAP00000018589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]