SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018597 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018597
Domain Number 1 Region: 72-218
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-29
Family DBL homology domain (DH-domain) 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018597   Gene: ENSMGAG00000016688   Transcript: ENSMGAT00000018934
Sequence length 225
Comment pep:novel chromosome:UMD2:4:19569800:19589442:-1 gene:ENSMGAG00000016688 transcript:ENSMGAT00000018934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTPRLAMASTDGVGGRRKNLALLRHRLYMGERRRTEPVFESSGAGEHGALRRSQSDRTEY
GQKLQEKMAPQSGSTSSATLPREDEETTKCMMARRVKIIAELMQTERDYINDLDLCIKEV
IQPLRNKQIARFDVDGLFSNIESVHQISAKLLSLLEEATTDVEPPMQVIGEVFLQIKGPL
EDTYKIYCYRHDDAHTMLESYEKDEELKQHLRHCVQSLKKMYEEE
Download sequence
Identical sequences G3USC5
ENSMGAP00000018597 ENSMGAP00000018597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]