SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018718 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018718
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily Sema domain 1.7e-30
Family Sema domain 0.011
Further Details:      
 
Domain Number 2 Region: 514-607
Classification Level Classification E-value
Superfamily E set domains 6.77e-17
Family Other IPT/TIG domains 0.0082
Further Details:      
 
Domain Number 3 Region: 157-209
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000562
Family Plexin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018718   Gene: ENSMGAG00000016626   Transcript: ENSMGAT00000018485
Sequence length 607
Comment pep:novel chromosome:UMD2:14:11871491:11889006:1 gene:ENSMGAG00000016626 transcript:ENSMGAT00000018485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVDRLTNWTRDVCYMRDGKSEDGTEVAYIEYDVSSNCVQLPADTLYAYPCGSDHTPSP
MASRVPLEAAPLLETTESRLTAVAVNVEDGHTIAFLGDSRGRLHKVYLGAMGDAHIYASL
AIQLNSMVSGDLLFDQLQEHLFVMTQSMVLKVPILECSLYSDCESCLALKDPYCGWCVLQ
GRCSRRSECLRSGLSEQWLWSFNSTQQCLSVQSLTPANISREEKRNIFLAISDLPSLHEE
EFYSCYFQDYESSAVLTESGIMCPSPDPNQTPALPAGADHVTIKLVVRFHDIFIASVDFS
FYDCAAVALLWKSAPCQKCVSSPWGCNWCVQQHLCTHKAACEEGTIIYNERNEELSWGPG
ACPCVQGIQGSSLFPVNVARKITLLGKNFHLYRDQQWDYECVLNLEGKMMMMDAYVEGDE
ANQSLCYITCQLNQYSYTAPQLEFNAVVFVQRRQHLRVDSAADLHVTFYNCSVGHTDCSR
CQTADSKYNCVWCGGDKPSCIFRGSCKEEIEDLCPAPLIHSVYPLSGPVEGGTRITITGS
NLGQKHQDIAETVTVAGIPCAVDAQEYEISSSIVCVTGGSWTERFGHIVVEVPGGGRGVS
EHIFTYQ
Download sequence
Identical sequences G3USP2
ENSMGAP00000018718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]