SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018747 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018747
Domain Number 1 Region: 63-369
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-77
Family Protein kinases, catalytic subunit 0.000000000571
Further Details:      
 
Domain Number 2 Region: 338-358,433-550
Classification Level Classification E-value
Superfamily PH domain-like 3.04e-45
Family Pleckstrin-homology domain (PH domain) 0.000000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018747   Gene: ENSMGAG00000006838   Transcript: ENSMGAT00000019461
Sequence length 555
Comment pep:known_by_projection chromosome:UMD2:16:7645896:7658916:1 gene:ENSMGAG00000006838 transcript:ENSMGAT00000019461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCVTSQLYDAVPIQSSVVLCSCPSPSMVRNQADSSTPPVISTCGSRQGSNMEGTAAESR
SSSNSLPQHTGQQPPQPRKKRPDDFKFGKILGEGSFSTVVLARELTSSREYAIKILEKRH
IIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSF
DETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSADSRQG
MLYLLCHMSQNIEHFTWKSPAKINSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKAKDLVEKLLVLDATKRLGCEEMGGYGPLKAHPFFESIVWENLHLQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSGSASSHSLSVPETSTPQTSGGNIEQYIHD
LDNNSFELDLQFSEDEKRLLLAKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLL
TEGPHLYYVDPVNKVLKGEIPWSLELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKK
IQEVWRHRYHQNAAK
Download sequence
Identical sequences G3USR5
ENSMGAP00000018747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]