SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018810 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018810
Domain Number 1 Region: 63-122
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Domain Number 2 Region: 211-338
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000106
Family Synaptotagmin-like (S variant) 0.022
Further Details:      
 
Domain Number 3 Region: 1109-1189
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000296
Family Synaptotagmin-like (S variant) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018810   Gene: ENSMGAG00000016478   Transcript: ENSMGAT00000019712
Sequence length 1194
Comment pep:novel chromosome:UMD2:Z:8973837:9088771:1 gene:ENSMGAG00000016478 transcript:ENSMGAT00000019712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGGLYGIDSMPDLRKKKPIPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTL
QALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCAECGVKCHEKCQDLLNA
DCLQRCAQSIQSHNAHPRYCHVIMKLCNKNKTNENNKKSMLSAIRFMALLAPSCYSERIK
NINFSAILEICAEWNAMQVVTSLCPYGHLLRLMTGSWNTFVTKVKLSKLKGNTQVLTMST
SRRWIQTVLSECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEM
DVWYNLEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHIQYTCLHEKNMHYICIFPSRKPI
KMADSSPGSHWKIDVNLKGKEEADKCRSPFSLQTPTVSIFACLLATHRICLVLATVQFMT
VVENVLIVFLQTELSINTKSCGIFATSPGGKQNCVFEQQACHDKQKTPTSIIYHHCPIDV
LSKKHDIRELAQKNSTTSNFLQIKSSLNRASYLLKKDKQNACKRTAFCFKFFTKHDIYTI
GFKLFFKQELLQKPQIIQPKDRNQERWWISILRYFQGTKRGSHLPFSTSSLRDELNCGSI
PENNLWPYCGHEMEYFGTEHEKHRLCKSADYMNLHFKVKWLYNEYVRDLPALKGKVPEYP
AFFCLFSMQWLDENEDVSLEFLHGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEI
IKKLECPDPVIVAHYNRRFAKTIGKVLMQYADILSKSFQSYCSKEKLPCILMNNIQQLRV
QLEKMFEAMGGKEEAEEKAADSDLSLRDCKSLINCILELLNFIFSKSGFQARIDECVKQM
SDILCQVKGAGNVAANARNTVAQDADNVLRPLMDFLDGNLPLWCTALKRFSLPSEEKQVW
AVSMETLEGMLLLPPSLLFTGIFKIHREQCRTSRGQAHRGMTGTDRLPLHSAALDSTEDA
AQQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVQTQTAQSCGWVIWGS
ETRRYCTETHSGVRDHSRVTTALSAATTGLLEWVTGVLWLLSVNADLFSAVQSHIARGSD
DQQKTVNFPGEMDRLYDFIRILGNEDGPDAYELQVCVKDYCFAREDRVLGIAVMQLRDIA
DKGSCACWCPLGRRIQMDETGLTVLRILSQRTNDEVAKEFVKLKSESRSTEEGT
Download sequence
Identical sequences G3USX6
ENSMGAP00000018810 ENSMGAP00000018810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]