SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018827 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018827
Domain Number 1 Region: 395-610
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-67
Family Protein kinases, catalytic subunit 0.00000000182
Further Details:      
 
Domain Number 2 Region: 101-173
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-24
Family Ras-binding domain, RBD 0.00035
Further Details:      
 
Domain Number 3 Region: 173-226
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000144
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018827   Gene: ENSMGAG00000013219   Transcript: ENSMGAT00000018841
Sequence length 611
Comment pep:known_by_projection chromosome:UMD2:1:58083890:58133523:-1 gene:ENSMGAG00000013219 transcript:ENSMGAT00000018841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNGTDFSVSSS
ASTDTVASSSSSSLSVAPSSLSVYQNPTDMSRNNPKSPQKPIVRVFLPNKQRTVVPARCG
VTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTT
HNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKF
FEHHPISQEETTLGETTPASGSYPSVPPSDSVGPPILPSPSPSKSIPIPQPFRPADEDHR
NQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGVRGEGGSTAGLSATPPASLPGSLTNVK
ALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKG
KWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEG
SSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGD
FGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQL
PYSNINNRDQV
Download sequence
Identical sequences G3USZ3
ENSMGAP00000018827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]