SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018933 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018933
Domain Number 1 Region: 161-317
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 7.32e-65
Family DNA-binding protein LAG-1 (CSL) 0.00000321
Further Details:      
 
Domain Number 2 Region: 8-163
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.46e-60
Family DNA-binding protein LAG-1 (CSL) 0.0000359
Further Details:      
 
Domain Number 3 Region: 318-430
Classification Level Classification E-value
Superfamily E set domains 3.66e-36
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018933   Gene: ENSMGAG00000017264   Transcript: ENSMGAT00000019541
Sequence length 470
Comment pep:known_by_projection chromosome:UMD2:22:5425690:5430479:-1 gene:ENSMGAG00000017264 transcript:ENSMGAT00000019541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSNPYQADLLRDGVRRYLQLPAEQTVLILHAKVAQKSYGNEKRFFCPPPCVYLGGPGWKL
KQEQLTARDVGEAGLRVWGYMGLDTMGSSLMETQKLSFEEQPDAKGFGCAKALYISDADK
RKHFRLVLKLFFSNGQEIGTFHSKLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRS
QTVSTRYLSVEGEAFIASARQWAAFTLHLADERCTQSEFPLREGYIRYGSVVQLICTATG
ITLPPLIIRKVSKQYAMLDVDEPISQLHKCAFQFQGSDRMYLCLSTEKVIQFQASPCPKE
ANRELLNDGSCWTIIGTETVEYSFSESLACAREPVSPVPLITALQLSGGGDVAMLEVQGE
HFHAHLKVWFGDVEAETMYRSPKSLMCVVPDISAFGSDWRWLRYPITVPLLLVRDDGLIY
SSSFTFTYTPEQSFLPGQQAPTDVPQDSDTLLNSIHQEFTRTNFHLFMQS
Download sequence
Identical sequences G3UT95
ENSMGAP00000018933 ENSMGAP00000018933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]