SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019124 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019124
Domain Number 1 Region: 253-414
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00018
Further Details:      
 
Domain Number 2 Region: 23-232
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.46e-50
Family BAR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019124   Gene: ENSMGAG00000003110   Transcript: ENSMGAT00000018816
Sequence length 414
Comment pep:known_by_projection chromosome:UMD2:20:2127964:2134772:-1 gene:ENSMGAG00000003110 transcript:ENSMGAT00000018816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLRKQSGILEDKENWGSLGAVWAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQG
QQGVDADKRSKKLPLTXPCVPCRKMLRLCGEAEDKLAQELIQFELQVERDVIEPLFVLAE
VEIPNIQKQRKHLAKLVLDMDSSRTRWQQSAKSSGLSSNLQPSGAKADALREEMEEAANR
VEICRDQLSADMYSFVAKEIDYANYFQTLIEVQAEYHRKSLALLQSVLPQIKAQQGECMQ
SCALTEAWMEKPSFGKPLEEHLAVSGREIAFPVEACVTMLLECGMQEEGLFRVAPSASKL
KKLKAALDCCVVDVQEYSADPHAIAGALKSYLRELPEPLMTFELYEEWIQASNIPEQEKR
LQALWNACEKLPKANYNNIRYLIKFLAKLTEYQDMNKMTPSNVAIVLGPNLLWP
Download sequence
Identical sequences G5E7T4
ENSMGAP00000019124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]