SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019233 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019233
Domain Number 1 Region: 1749-1984
Classification Level Classification E-value
Superfamily Plakin repeat 1.57e-75
Family Plakin repeat 0.00000279
Further Details:      
 
Domain Number 2 Region: 1991-2067
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000798
Family Plakin repeat 0.0000613
Further Details:      
 
Domain Number 3 Region: 702-822,849-876
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000272
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 4 Region: 186-315
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000792
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 5 Region: 628-740
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000108
Family Spectrin repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019233   Gene: ENSMGAG00000003779   Transcript: ENSMGAT00000018997
Sequence length 2086
Comment pep:known_by_projection chromosome:UMD2:3:11826312:11851509:-1 gene:ENSMGAG00000003779 transcript:ENSMGAT00000018997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLLQLQEQMRALYKAISVPRARRASSKGGGCYSSQSGSGWDEYTKRVTSECLNWMRQQKA
EMELVKWGFDAASIEQQISDHRRTHNAIGDYRWHLDKVKTDLREKAAVHQLEEEYEGLLK
YSFERMDQLRQFQNLIQATSREIMWINDCEEEELLYDWSDRNTDISRKQEAFSKRMSELE
LKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQ
FFEEAQATESYLKNLQDSIRKKFICDKSMSLQSLLEQIKELENERERILEYKRQVQSLVN
KSRKIVQLKPRNPDYRSNKPIILKALCDYKQDLKTVRKGDECILKDNNERSKWLVTGPGG
VDMLVPSVSLIIPPPNPLAVDLATKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKI
RAMTIAKLKTMRKEDYQKIITDLEIHYQEFLRNSQGSEMFGDEDKRKIQTQFTDAQKHYQ
TLIIQLPNQPRQPQTVIPTESCPVGTSNTIIVNERNREHDKQEAWLLMELQKLRRQIEAS
EIRMVQRAPLGVDQGALHDFSVRIQDLEGVQNDSQIMAETLNKHKDLLPNFRGCEKYVYL
QSEINALFQKLENINGVSAGYLDSLNALRCLLQLILQTEDVIRVFEVRLSEEETVPLDLD
KVEAYRACLKKMKSDLNMKKSLLNTLENELQKMLQIHSQSCQSYTLYDMDVGKFSDKVTQ
LIDRWQRAEKQIDNRSWDLERQIKQLKTYRDLYQALCKWICDAKRRQDSIESTKLCDSNT
IMRYLHDQKNLHSEICGKRDKVEELLKHADQCSAAIKDYELQVASYSSGLETLLNIPIKK
CVVQSPAVLILQEASEAQARYIELLTRSGDYYKFLSEMLKSMEDLKMKATKIELLEEELR
LARDSNSETNNKHKFLEQNLQKYQMDISQLKAKLMSLEEMKRQAEMDGNSAKQNLDKCYA
QIKDLNDRITRLTYETEDEKRKRKLLEDRYEQQKNDYDQLQKTRQNEKDSLGWQKLESEK
VIKEKEYEIERLRVLLQDEGTRKREYENELAKVRNQFSEEMSNLKNKYETEINIKKTTIQ
QIAAQKDDDAKGLRAQVDRLSRENRDLKDEIVRLNDAILQTTDQRRRAEEDALQQKACSS
EVSQQKHQLELELKQIIQLRGEDNSRYKQALEEAAATIQDKTKELERLKLQLQEEAKSRW
ELENELAKVRNSYDEEIISLKNKYETEINITKTTIHQVTMQKEEDTNNYRTQLDNAMREN
RNLCEEIRRLKNTITQTTDNLRKIEENAQQQKAAGSELSQKKQQLEIELKQVIQRHSDES
MRYKQSLDDASKTIKERNKEIERLRKLLDIQKHKLEEELCRQNKNVMEETARRKKLEEEV
EGMRRSLREQSVKITNLTQQIEEVSIVKKRNEDDLRHQREVLDGHVREKQRYMEEIRKYT
SDIETLRRQLVQEQEQLKQAHLRNEHLQKTSEEKSKNLNECKIEIERLQSLTENLTKEHL
LLEEELRNVRLEYDDLRMVRSEVDEKNSAIAELKNQLQTSNKQTLELQGLINDLQKEREK
LRQEIEKFQKQALEASNRIQESKNQYNHIMQERETLLIKMSALEQDKARLQRLEEELNRL
KVNLESESRLKQRLENEKQQILNDLNQWKSQHSRTEESIRKIQCEREKSEREKNTLRSEI
ERLQMEIKRIEERYRCRLEETAVKNQSELESERLRLQREIEKLKQRPYGSHRSTQTEEDF
CIDASKLVFNGLRKKITAMQLYECQLIDKLTLDKLLKGQRSVEEVTADIEPFLKGAGAIA
GVSVLPRQKYSFVEAKRNQLLTAENAVLLLEAQAATGGVIDPHRNEVLTVDSAIARDLID
FDDREQIYTAEKAVTGFKDPFSGKTVPLSEAMKKNLIDRETGMRLLEAQLAVGGIVDPVN
SVFLPKDVALSRGLIDKDLYRILNNCQSTTKNFIDPSTKKAVTYVQLKEKCRIEPHTGLL
LLPVQKRSMSFQGIRQPVSADALLEAGIIKESTRNDLERGAITVEEVSERIINFLQGSSC
IAGIYNEATKEKLGIYQAMKIGLVRPEPSLGTKTQKLETSFLCFKQ
Download sequence
Identical sequences G3UTZ5
ENSMGAP00000019233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]