SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019282 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019282
Domain Number 1 Region: 317-565
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.96e-99
Family STAT DNA-binding domain 0.000000038
Further Details:      
 
Domain Number 2 Region: 135-316
Classification Level Classification E-value
Superfamily STAT 1.84e-60
Family STAT 0.00001
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 3.79e-42
Family Transcription factor STAT-4 N-domain 0.000000626
Further Details:      
 
Domain Number 4 Region: 566-703
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-40
Family SH2 domain 0.00000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019282   Gene: ENSMGAG00000016413   Transcript: ENSMGAT00000019462
Sequence length 749
Comment pep:known_by_projection chromosome:UMD2:7:7942038:7981172:-1 gene:ENSMGAG00000016413 transcript:ENSMGAT00000019462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWSQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWVESQDWEAASNNEAMATILLQNL
LIQVDEQLDRVSQEKNLLLIHNLKRIRKLLQGKYHGNPMHIAVIISNCLREERRILAAAS
MPVQGPLEKSLQNSVVSERQRNVEHKVSAIKNSAQMTDQDVKYLEDLQEEFDFRYKTIQS
LEQSDKNSALIKQEMLALQAMLNTLDYKRKEVLSKIGRVIHEIDMLMSNMLTEELLDWKR
RQQIACIGGPLHGGLDQLQNCFTLLAESLFQVRRQLEKLDELLTRLTYDGDPIPVQRPQL
LEKVNFLLYNLFRNSFVVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQIRVK
ATIDKNVSTVSNRRFVLCGTHVKAMNMDESANGSLSVEFRHLQPKEMKSSAGSKGNEGPH
MVTEELHSISFETQVCLYGLTINLETSSLPVVMISNVSQLPNAWASIIWYNLSTNDPQNL
SFFNNPPAATLSQLLEVLSWQFSSYVGRGLNSEQLNMLAEKLMGQQVSYSDYQLSWAKFC
KEHLPGKSFTFWVWLEAILDLIKKHILPLWIDGYVMGFVSKEKERILLKDKTPGTFLLRF
SESNLGGITFTWVDQLENGEVTFHSVEPYNKGRLAALPFADILRDYKVIMADNVPENPLK
YLYPDIPKDKAFGKHYSCQPNEVSKPSDGGVKGYVPSVFIPVSKILNDSTDPHSPSDLLP
MSPSVYAVLREHLSPTAIETALSSPYSTD
Download sequence
Identical sequences G3UU36
ENSMGAP00000019282 XP_003207479.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]