SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019393 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019393
Domain Number 1 Region: 29-173
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-40
Family Phosphotyrosine-binding domain (PTB) 0.00000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019393   Gene: ENSMGAG00000011507   Transcript: ENSMGAT00000020707
Sequence length 535
Comment pep:known_by_projection chromosome:UMD2:10:26756874:26837695:-1 gene:ENSMGAG00000011507 transcript:ENSMGAT00000020707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTETELQVAVKTSTKKDSKKKGQDRSEATLIKRFKGDGVRYKAKLIGIDEVSAARGDKL
CQDSMMKLKGIVAAARSKGEHKQKIFLTVSFGGIKIFDEKTGLLQHHHAVHEISYIAKDI
TDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREEMEKKAQKDKQC
EQAVYQVPTSQKKEGVYDVPKSQPVSLENGNLLLDIDENLGSVTQVVVTLKMLLLXSTPP
DVTSPPTPATPGDAFIPSSSQSLPASTDMFGSVPFSTAAVPSGYVAMGAVLPSFWGQQPL
VQQQLAMGAQPPVAQVMQGGQPIAWGQPGIFPPAQQPWPSVAGQFQPTAFMPTQTVLPLQ
AAMFQGTIAPIATVPPTSDSNRSSPQTDRPRQKMGKEMFKDFQMAQPPPVPSRKPDQPSL
SCTSEAFSSYFNKVGMAQEADDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSS
ASHTSDPAADDLFEEGFESPSKSEEQEAPDESQASSNSDPFGEPTGDTISPQVGS
Download sequence
Identical sequences G3UUD1
ENSMGAP00000019393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]