SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019482 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019482
Domain Number 1 Region: 15-83
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 8.97e-23
Family Complement components 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019482   Gene: ENSMGAG00000013976   Transcript: ENSMGAT00000019603
Sequence length 83
Comment pep:novel chromosome:UMD2:1:79977721:80008796:-1 gene:ENSMGAG00000013976 transcript:ENSMGAT00000019603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRRASVSVLGDIMGTAMQNMHQLLLMPFGNGEQNMVLFAPNIYVLDYLNKTRQLSEDVKS
KTIGYLVSGYQKQLSYKHPDGSY
Download sequence
Identical sequences G3UUL7
ENSMGAP00000019482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]