SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019560 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019560
Domain Number 1 Region: 2-166
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-48
Family DBL homology domain (DH-domain) 0.0000434
Further Details:      
 
Domain Number 2 Region: 154-284
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-35
Family Pleckstrin-homology domain (PH domain) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019560   Gene: ENSMGAG00000017324   Transcript: ENSMGAT00000020474
Sequence length 285
Comment pep:novel chromosome:UMD2:3:65905226:65927250:1 gene:ENSMGAG00000017324 transcript:ENSMGAT00000020474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQMLFSNIEDILAVHKNFLSLVEECLQPEPSAHHEVGTCFLHYKEKFRIYDEYCSNHEKA
QKVLLDLNKIRTVRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLLKELLKRTPR
KHSDYAALMEALQAMKAVCSNINEAKRQMEKLEFLEEWQSHVEGWEGSNITDTCTEMLRS
GLLLKISAGNIQERIFFLFDNLLVYCKKKHSNQWKFVHKGRINTEVMEVENVDDGTXTDY
HSSGHTVINGWKIHNTAKNKWFVCMAKTPEEKQEWLEAILKERER
Download sequence
Identical sequences G3UUU1
ENSMGAP00000019560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]