SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019629 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019629
Domain Number 1 Region: 74-213
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-34
Family Pleckstrin-homology domain (PH domain) 0.00054
Further Details:      
 
Domain Number 2 Region: 230-328
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.1e-28
Family DEP domain 0.0027
Further Details:      
 
Domain Number 3 Region: 10-86
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-27
Family DBL homology domain (DH-domain) 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019629   Gene: ENSMGAG00000017324   Transcript: ENSMGAT00000019140
Sequence length 332
Comment pep:novel chromosome:UMD2:3:65910076:65936578:1 gene:ENSMGAG00000017324 transcript:ENSMGAT00000019140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGGRKNTDVPLEGYLVTPIQRICKYPLLLKELLKRTPRKHSDYAALMEALQAMKAVCS
NINEAKRQMEKLEFLEEWQSHVEGWEGSNITDTCTEMLRSGLLLKISAGNIQERIFFLFD
NLLVYCKKKHRRLKNSKASTDGHRYLFRGRINTEVMEVENVDDGTADYHSSGHTVINGWK
IHNTAKNKWFVCMAKTPEEKQEWLEAILKERERRKGLKLGMEQDTWVMISEQGERLYKMM
CKQGSLIKDRKRKLTTFPKCFLGSEFVSWLLEIGEIHRSEEGVHLGQALLENGIIHHVTD
KHQFKPEHMLYRFRYDDGTYYPRSEMQEVISK
Download sequence
Identical sequences G3X8M9
ENSMGAP00000019629 ENSMGAP00000019629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]