SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019640 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019640
Domain Number 1 Region: 116-414
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.92e-115
Family Pancreatic carboxypeptidases 0.000000027
Further Details:      
 
Domain Number 2 Region: 21-110
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.23e-26
Family Pancreatic carboxypeptidase, activation domain 0.0000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019640   Gene: ENSMGAG00000003148   Transcript: ENSMGAT00000018653
Sequence length 420
Comment pep:known_by_projection chromosome:UMD2:1:1064228:1073000:1 gene:ENSMGAG00000003148 transcript:ENSMGAT00000018653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMKVLLVFTALLVGTFSEQLFVGDQVLRAVASDEEQIALLRALGEQVDLQIDFWRDPTKP
GRPADLRVPFSRLQAVKVFLESHGISYSIMIEDVQHLLDEEKRTMMLSRRMERSANKFNF
ASYHTLEEIYDWMDTLVADHPNLVSKIQIGESYEKRPLYVLKFSTGGSNRPAVWLDTGIH
SREWVTQATGVWTANKLAEDYGHDPTVTSLLDTVDIFFEIVTNPDGYAFTHSSNRMWRKT
RSRHSGSLCVGVDPNRNWDAGFGGSGASGNPCSETYRGPYANSEPEVQAIVDFVKNHGNI
KAFISIHSYSQLLLYPYGYTTTAVPDKEELHQVAKEAVAALSSLYGTNYKYGSIITTIYQ
ASGGTIDWTYNQGIKYSFTFELRDTGRYGFLLPASQIVPTAEETWKALEVIMAHTRGHLY
Download sequence
Identical sequences G3X8P0
ENSMGAP00000019640 ENSMGAP00000019640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]