SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019754 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019754
Domain Number 1 Region: 153-191
Classification Level Classification E-value
Superfamily E set domains 0.000000000131
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019754   Gene: ENSMGAG00000000791   Transcript: ENSMGAT00000020543
Sequence length 195
Comment pep:known_by_projection chromosome:UMD2:24:415808:705392:1 gene:ENSMGAG00000000791 transcript:ENSMGAT00000020543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVSLCFPRGVRTEQDLYVRLIDSVTKQPITYEGQNKNPEMCRVLLTHEVMCSRCCEKKSC
GNRNETPSDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSD
NMFVHNNSKHGRRARRLDPSEALLFFWFCSATPCIKAISPSEGWTTGGAMVIIIGDNFFD
GLQVVFGTMLVWSEV
Download sequence
Identical sequences G3UV80
ENSMGAP00000019754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]