SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000293 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000293
Domain Number 1 Region: 8-162
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 4.05e-67
Family TRADD, N-terminal domain 0.00000522
Further Details:      
 
Domain Number 2 Region: 204-299
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-17
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000293   Gene: ENSMGAG00000000909   Transcript: ENSMGAT00000000929
Sequence length 305
Comment pep:known_by_projection chromosome:UMD2:13:288597:297627:1 gene:ENSMGAG00000000909 transcript:ENSMGAT00000000929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAGSSAPWIGSAYLFLQSTCKTIILPNLYESAQKKPCVFKALKLALADSTGSVNGVDML
KVHCSHPHLIVQLKFCKQENCRRFLQSYREGLLQKSLQNHLQLSLAMTTVPLEMELKAGN
EHLDNMLKDEDRCLECIYREKPDRLRDEEITELEERLKSLILHQNINNNMPSKDCMSLNS
PSLPSQGSSLSPQVTFLFQGQQFDNRMLTPDDHQKFAKLVSKKWKQVGRSLQKNCRALRD
PVIDNLAHEYDREGLYEQAYQMLLRFIQSEGKKATIARLIAALEENGLTSLSEELLGLHS
NEDDS
Download sequence
Identical sequences G1MQE2
ENSMGAP00000000293 ENSMGAP00000000293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]