SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000859 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000859
Domain Number 1 Region: 334-468
Classification Level Classification E-value
Superfamily C-type lectin-like 8.59e-43
Family C-type lectin domain 0.000098
Further Details:      
 
Domain Number 2 Region: 196-329
Classification Level Classification E-value
Superfamily C-type lectin-like 2.65e-36
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 3 Region: 784-915
Classification Level Classification E-value
Superfamily C-type lectin-like 6.92e-34
Family C-type lectin domain 0.00033
Further Details:      
 
Domain Number 4 Region: 924-1074
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-32
Family C-type lectin domain 0.00037
Further Details:      
 
Domain Number 5 Region: 479-613
Classification Level Classification E-value
Superfamily C-type lectin-like 6.01e-32
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 6 Region: 1082-1211
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-29
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 7 Region: 629-772
Classification Level Classification E-value
Superfamily C-type lectin-like 8.27e-29
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 8 Region: 1227-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-27
Family C-type lectin domain 0.0078
Further Details:      
 
Domain Number 9 Region: 2-133
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.09e-22
Family Cysteine rich domain 0.003
Further Details:      
 
Domain Number 10 Region: 133-191
Classification Level Classification E-value
Superfamily Kringle-like 9.71e-21
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000859   Gene: ENSMGAG00000001316   Transcript: ENSMGAT00000001506
Sequence length 1441
Comment pep:known_by_projection chromosome:UMD2:29:1742727:1757430:1 gene:ENSMGAG00000001316 transcript:ENSMGAT00000001506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDSKVFLIYNVGAQGCLETKDSLVRLTKGCNTSSPAHQWKWVSRNRLFNVGAMQCLGVSW
HGGNATAGLHPLATYECDRESVNMRWSCRGLGEQLSQHLGARPGNASLDRGDQARSSQWR
TYGTEEDLCSVPYSEIYTIQGNSHGKPCTIPFKYDNQWFHECTSTGREDGHLWCATTQDY
GKDERWGFCPIKSNDCETFWDKDHLTNSCYQFNFQSTLSWREAWNSCEQQGANLLSITEI
HEQTYINGLLTGYSSTLWIGLNDLDINGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIR
TESSGGWQNRDCGIALPYVCKKKPNATTDPFLTDSWSEVKVDCEPSWQSFQSNCYRLVGE
KKSWQDAKKTCLRSGGDLVSIHTLSELEFVTKQVKQDVEELWIGLNDLKLQMNFEWSDGT
PVRFTYWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKPGRVSQEKEEDDH
GCRKGWKWHSPSCFWLGEDRVTYSDARKMCSDYGSTLVTITNRFEQAYVSSLIYGWDGEY
FWTALQDINETGAFRWLSGDEVMYTHWNRDQPGYNKGGCVALATGSSMGLWEVKNCSTFK
AKYICRQNLGTPVNPELPSAYPTPSLTGSCPLGWSADPKLRHCYKVFNFDKLQEKKTWIA
AQEFCRELGAQLLSLGSYEEEHFVANTLNKIFGESEPEIHEQHWFWIGLNRRDPAGDRSW
RWSDGLGFFYHNFDRSNYDDDDIRNCAVLDLASLQWMPMQCEAQLDWICKLPKGTDVKEP
EITTQGSKEWVKYQEAEYKFFEHHSTWVQAQRICSWFQAELVSVHSESELRFLGQNLKKF
SRGQEQHWWIGLHTYENDGRFKWSDGSLLNFVSWAPGKPRPINKDKKCVYMTASREDWGD
QKCPTALPYICKRSNATAVKPSIPPPPAPTSGGCPRGWVPFLSKCFSFNGHDKADIVKWP
EAKQACENQGAVLATISSPLEQAFITSMLLNISFDLWIGLHDAKKEFQWVEGEPLRHVSW
APGEPSECSSSSPGDKPTNCVLVWHGSPPHFTGRWDDRSCVEEKHGYICQRSIDPTLSPA
RTPYPPSPTGTLFYHNSTYRILQKPLRWHEALLLCETLNATLATIPDPYSQAFLTQAISS
LRAPLWIGLANNEGGRSYSWLSEENLFYANWQDGEPQQAAGCAYMDVDGSWRTAGCDTKL
QGGICQLQSGPPRTHKWSYSGSCPKSLEDSSWIPFRDHCYTFHMEITLGQKDAMRRCQKV
GGTVLSIQDEMENVFVWEHLQAYEGPSKGAWLGMTFNPKGGTLVWHDNTAVNYSNWGQHD
TGPSMLSQNSCYWIQSSNGVWRLGSCTNVTMGVICKIPRVEESSFSRAALPENTTAIAVV
VLSALALSALLGIAIFLYKRRRSSERGAFESARYSRTTSNPSEAAEKNILVSDMEMNEQQ
D
Download sequence
Identical sequences G1MRM7
ENSMGAP00000000859 ENSMGAP00000000859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]