SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001384 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001384
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000377
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001384   Gene: ENSMGAG00000001886   Transcript: ENSMGAT00000002040
Sequence length 138
Comment pep:known_by_projection chromosome:UMD2:11:2544496:2550946:-1 gene:ENSMGAG00000001886 transcript:ENSMGAT00000002040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDSGRDGYIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDGKLSFREFLLIFHKAAAG
ELEEDSGLLTLAKLSEIDVSIEGVKGAKNFFEAKVQALSSASKFEAEIRAEQDERKREEE
ERKHRRAAFRELKSAFTQ
Download sequence
Identical sequences G1MSR4
ENSMGAP00000001384 ENSMGAP00000001384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]