SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002410 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002410
Domain Number 1 Region: 722-1074
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.13e-54
Family Ankyrin repeat 0.0000507
Further Details:      
 
Domain Number 2 Region: 442-708
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.81e-49
Family Ankyrin repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 218-406,437-518
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.2e-46
Family Ankyrin repeat 0.00019
Further Details:      
 
Domain Number 4 Region: 45-154
Classification Level Classification E-value
Superfamily POZ domain 9.42e-19
Family BTB/POZ domain 0.0066
Further Details:      
 
Domain Number 5 Region: 1099-1158
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.21e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002410   Gene: ENSMGAG00000002751   Transcript: ENSMGAT00000003087
Sequence length 1164
Comment pep:known_by_projection chromosome:UMD2:21:3410337:3438346:1 gene:ENSMGAG00000002751 transcript:ENSMGAT00000003087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVAKLEKHLMLLRQEYVKLQKKLADTERRCNLLAAQANQDNASDTFISRLLAIVAELYQQ
EQYSDLKIKVRDKHISAHKFVLAARSDAWSLANLASTEELDLSADADPEVTMAMLRWIYT
DELELREDDIFLTELMKLANKFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLL
NYCAEIIASHWDDLRKEDFSSMSAQLLYKMFKSKTEYPLHKAIKVEREDVVFLYLIEMDS
QLPGKLNELDQNGDLALDLALSQRLESIATTLVNYKADVDRADRRGWSLLHKAIQRGDKF
AANFLIKNGARVNAATLGDQETPLHLVASYSPKKHSPDVMAEMAQIAESLLQAGANPNMQ
DSKGRTPLHMSIVVRNEPVFSQLLHCKQLDLELKDHEGSTALWLAVQYITVSSDQSVNPF
EDAPVVNGTSFDENSFAARLIQRGSNTDAPDTVTGNCLLQRAAGAGNEAASLFLATHGAK
VNHQNKWGETPLHTACRHGLANLTAELLQQGANPNIQTAEVAPGQKDASSPTAENVYLQT
PLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTGMHTIA
AQLLGSGASINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTQDGETALQLAIKN
QLPLVVDAICTRGADMSVPDEKGNPPLWLALENNLEDIASTLVRHGCDSTCWGSGPSGCL
QTLLHRAIDENSEQIACFLIRSGCDVNSPRKPGPNGEGEEEAHDGQTPLHLAACWGLEEV
IQCLLEFGANVNAQDAEGRTPIHVAISNQHNVIIQLMISHPEIKLNVRDRQGMTPFACAM
TYKNNKAAEAILKREPGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNSRVQDAS
KLTPLHLAVQAGSEIIVRNLLLAGAQVNELTKHRQTALHLAAQQDLPTICSVLLENGVDF
AAVDENGNNALHLAVMHGRLNNIRVLLTECNVDAEAFNIRGQSPMHILGQYGKDNAAAIC
DLFLECMPEYPLDKPDAEGNTVLLLAYMKGNANLCRAIVRAGARLGVNNNQGVNIFNYQV
ATKQLLFRLLDMLTKEPPWCDGSNCYECTAKFGVTTRKHHCRHCGRLLCHKCSTKEIPII
KFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences G1MUZ4
ENSMGAP00000002410 ENSMGAP00000002410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]