SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002906 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002906
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 6.28e-60
Family Dystroglycan, domain 2 0.000000556
Further Details:      
 
Domain Number 2 Region: 498-600
Classification Level Classification E-value
Superfamily Cadherin-like 2.04e-17
Family Dystroglycan, N-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 61-159
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-16
Family Dystroglycan, N-terminal domain 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002906   Gene: ENSMGAG00000003230   Transcript: ENSMGAT00000003596
Sequence length 877
Comment pep:known_by_projection chromosome:UMD2:14:2475511:2486732:-1 gene:ENSMGAG00000003230 transcript:ENSMGAT00000003596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVGCVLQPPFLGRTLLPVLLLAASAHCHWPSEPAEVLKDWENQLEASMHSVLSDLRETV
PAVVGIPDSSAVVGRFFRVSIPTDLIASNGEVVQVSEAGKESLPSWLHWNAESSSLEGLP
LDTDKGVHYISVTTLQPFPNGSYVPQAANVFSVEVHQEDHSEPQSVRAAAQDTGDAAPFV
CGAEEPVTILTVILDADLTKMTPKQRIELLNRMRSFSEVELHNMKLVPVVNNRLFDMSAF
MAGPGNAKKVVENGALLSWKLGCSLSQNSVPNISKVEAPAKEGTMSARLGYPVVGWHIAN
KKPHLPKRMRRQINATPTPLTAIGPPTTAAQEPPTRIVPTPTSPAIAPPTETTAPPVREP
IPLPRKPTVTIRTRGPIVQTPTLGPIQPTRLVEGTGMVSVPIRPTMPGYVEPTAVITPPT
ATTKKPRVSTLKPATPSTTDSSTATTRRPTRRPKTPRPTKPPSTTRSPISKLTTASPPTR
VRTTASGIPRPWEPNEPPKLTNHIDRVDAWEGTYFEVKIPSDTFYDKEDTTTDKLQLTLK
LKEQQMIEENSWVQFNSTSQLMYGMPDRSHVGKHEYFMYATDKGGLFAVDAFEIHVHKRP
HGDKSPVKFKAKLEGDHNAVANDIHKKIMLVKKLALAFGDRNSSTITVQDITKGSIVVEW
TNNTLPLEPCPREQIRTLSRKIADDSGGEPGVSNILQPEFKPLNVSVVGSGSCRHIQFVP
VTKDGRVISEATPTVVAGKDPEKSSEDDVYLHTVIPAVVVAAILLVAGIIAMICYRKKRK
GKLTIEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSMPETT
PLNQDTIGEYTPLRDEDPNAPPYQPPPPTAPMEGKGS
Download sequence
Identical sequences G1MW21
ENSMGAP00000002906 ENSMGAP00000002906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]