SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003256 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003256
Domain Number 1 Region: 416-647,681-748
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 8.72e-52
Family Diacylglycerol kinase-like 0.018
Further Details:      
 
Domain Number 2 Region: 6-91,150-177
Classification Level Classification E-value
Superfamily EF-hand 1.64e-43
Family EF-hand modules in multidomain proteins 0.0018
Further Details:      
 
Domain Number 3 Region: 153-242
Classification Level Classification E-value
Superfamily EF-hand 3.53e-20
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 4 Region: 246-315
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.83e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0035
Further Details:      
 
Domain Number 5 Region: 315-383
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000239
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003256   Gene: ENSMGAG00000003486   Transcript: ENSMGAT00000003955
Sequence length 774
Comment pep:known_by_projection chromosome:UMD2:11:4646955:4660953:-1 gene:ENSMGAG00000003486 transcript:ENSMGAT00000003955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDGGWITLSPAEFAQLQQYTDYSTKKLKDVLEEFHGDGVLSRYNPEQPIDYEGFRLFMK
TYLEVEVPEELCQHLFTSFKRKSCQAAPEAQRQSPSISQLEPKSLDAGISIQTEVACAPV
TVLEKRLPFSLRKSHSALKAAPQHPPAPLAQVVYLKDIVCYLSLLERGRAEDKLEFMFRL
YDTDGNGILDSSELDRIINQMVHVAEYLEWDSTELKPILKAMMEEIDYDHDGNVTLEEWI
RGGMTTIPLLVLLGMETNVKDDGQHAWRLKHFKKPAYCNFCRTMLLGVRKQGLCCSFCKY
TVHERCVSKDIASCISTYVKSKRNTNVMQHTWIEGNSPVKCDRCHKSIKCYQGITGLHCV
WCQVTLHNKCASHVKPECDGGPLRDHILLPSYICPVVLVRGHPVPTPLGPCPVPTPXSGG
RQGERVLRKFHYLLNPRQVYNLDRGGPAPGLSFFRDTPDFRVLACGGDGTVGWILDCIDK
ANLLKHPPVAVLPLGTGNDLARCLRWGGGYEGGSLMKVLKDIEHSTEVMLDRWQIDVIPS
DKEANGDPVPYSIINNYFSIGVDASIAHRFHIMREKHPEKFNSRMKNKLWYFEFGTSETF
AATCKKLHDYVEVECDGTLLDLSNASLEGIAVLNIPSMYGGSNLWGETKKQRGYNRLSKK
APEKPHAAVVTDAKELKFCAQDLSDHLLEVVGLEGAMEMGQIYTGLKSAGKRLAQCSAVT
IRTSKLLPMQVDGEPWMQPSCTVKITHKSQVPMLLGPPQKSSFFFLKRRNRTRD
Download sequence
Identical sequences G1MWU5
ENSMGAP00000003256 ENSMGAP00000003256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]