SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004662 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004662
Domain Number 1 Region: 658-853
Classification Level Classification E-value
Superfamily Sec7 domain 1.44e-72
Family Sec7 domain 0.00000246
Further Details:      
 
Domain Number 2 Region: 417-598,1113-1514,1674-1781
Classification Level Classification E-value
Superfamily ARM repeat 2.06e-28
Family Armadillo repeat 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004662   Gene: ENSMGAG00000004762   Transcript: ENSMGAT00000005383
Sequence length 1809
Comment pep:known_by_projection chromosome:UMD2:22:6862513:6889073:1 gene:ENSMGAG00000004762 transcript:ENSMGAT00000005383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHFFKKRKNMRLVKYLRKLLLSLQNQKRSSSDVRLRFGTALYEIKTELEKQRPREGTVAP
PKANFIEADKYFLPFELACQSKSPRIVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDR
IVDTICNCFQGPQTDEGVQLQIIKALLTAVTSPYIEIHEGTVLQTVRTCYNIYLASKNLI
NQTTAKATLTQMLNVIFTRMENQSVQESREVGKTNQQKSQSPAIQAGTRSPKMGQLKHLH
QEGKCTAPVSVELTNGEPERTGYGNVKSEQDLVPSASGEQELLSVVFLLKEGEEKIIMET
TDGGKEMVKGILEDVVESAVKVAEEKQVTEMAKALPAVETADTVLSGSSSENVQTNGIPD
DGQSVSSTDNLEADISGHQAAAKFSHVLQKDAFLVFRSLCKLSMKPLGDGPPDPKSHELR
SKIVSLQLLLSVLQNAGPVFRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTL
LSNFKTHLKMQIEVFFKEIFLNILETSSSSFEHKWMVIQTLTRICADAQCVVDIYVNYDC
DLNAANIFERLVNDLSKIAQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLY
VNPNHQTSLGTYKPSEQEIAEGKCLDSGGRRSSVSSLDSTVSSGVGSVGTQTAVPDDPEQ
FEVIKQQKEIIEHGIELFNKKPKRGIQYLQEQGMLGSTAEDIAQFLHQEERLCSTQAGEF
LGEGSKFNKEVMYAYVDQLDFCGKDFVSALRIFLEGFRLPGEAQKIDRLMEKFAARYIEC
NQRQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPVEYLS
TIYEEIEGKKIAMKETKEYAIATKCSKPSVANEKQRRLLYNLEMEQMAKTAKALMEAVSH
AKAPFTSATHLDHVRPMFKLVWTPLLAAYSVGLQNCDDTEVASLCLEGIRCAIRIACIFG
MQLERDAYVQALARFSLLTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCI
SQLELAQLIGTGVKTRYLSGAGREREGIIKGYASGGEEFMGLGLGNLVGSGADKRHMASI
QESVGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKI
VEISYYNMNRIRLQWSRIWQVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELAN
FRFQKDFLRPFEHIMKKNRSPTIRDMVIRCIAQMVNSQAGNIRSGWKNIFAVFHQAASDH
DGNIVELAFQTTAHIVTNIFQQHFPAAIDSFQDAVKCLSEFACNVAFPDTSMEAIRLIRY
CAKYVSERPQVLREYTSDDMNVAPGDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMF
EIMKSYGHTFEKHWWQDLFRIVFRIFDNMKLPEQQTEKSEWMTTTCNHALYAICDVFTQF
YEALNEILLPDILAQLHWCVKQENEQLARSGTNCLENLVILNGQKFSPEVWGQTCNCMLE
IFKTTIPHVLLTWRPAGMEEDSAEKHLVRDLDLDRQSLSSVDKNASERGQSQLSNPTDES
WKGGPYTNQKLFAGLLIKCVVQLELIQTIDNIVFYPATSKKEDAEHMAAAQRDALDADIH
IDTEDQGMYKHMSSHHLFKLLDCLQESHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQ
ETSSLACCLRILFRMYVDENRRDSWDAIQQRLLSVCSEALAYFITVNSESHREAWTNLLL
LLLTKTLKISDEKFKAHASTYYPYLCEIMQFDLIPELRAVLRKFFLRIGVVFKICVTEEQ
IRTTGTNLP
Download sequence
Identical sequences G1MZY8
ENSMGAP00000004662 ENSMGAP00000004662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]