SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005251 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005251
Domain Number 1 Region: 141-674,808-1003
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5e-260
Family Motor proteins 0.00000000169
Further Details:      
 
Domain Number 2 Region: 1681-1870
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000666
Further Details:      
 
Domain Number 3 Region: 18-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000331
Family Ras-binding domain, RBD 0.024
Further Details:      
 
Domain Number 4 Region: 1002-1053
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000478
Family Nucleotide and nucleoside kinases 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005251   Gene: ENSMGAG00000005297   Transcript: ENSMGAT00000005983
Sequence length 2132
Comment pep:known_by_projection chromosome:UMD2:30:3501793:3537325:-1 gene:ENSMGAG00000005297 transcript:ENSMGAT00000005983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKDADSAVCQTKAAYHLHVYPQLSTESAPCCKVTATKDTTSSDVIKDVINILNLDVSK
NYVLVEVKETGGEEWVLDTNDSPVHRVLLWPRRAQDEHPQKDGYYFLLQERNTDGTIKYA
QMQLLSKETDARRLVERGFLPWQQEDFDDLCNIPNLTEKTLLENLKCRFLKHKIYTYAGS
ILIAINPFKFLPIYNPKYVKLYENHQLGKLEPHIFAIADVAYHTMLKKHVNQCIVISGES
GSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFIQ
VNYLENGVVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVNEEERKEFHLKQPEDY
SYLNQCNLKIEDGEDLRHDFERLKQAMEMVGFLSATKKQIFSVLSAILYLGNVTYKKKAT
GRDEGLEVGPPEVLDILSQLLKVKREILVEVLTKRKTVTANDKLILPYSLSEAITARDSM
AKSLYSALFDWIVLRINHALLNKKDMEESVTCLSIGVLDIFGFEDFETNSFEQFCINYAN
EQLQYYFNQHIFKLEQEEYKSEGITWHDIDYTDNVACIHLISKKPTGLFYLLDEESNFPR
ATNQTLLAKFKQQHEENKFFVATPVMEPAFIIRHFAGKVKYQIKDFREKNMDYMRPDIVA
LLRSSDSAYVRELIGMDPVAVFRWAVLRAAVQAMAVFAEAGRQRAQKTAGVVRQGPRVPL
GELQRSNTPVEKVYRSELHTSLYLCTTKQQLRTKYKSYRECFVLLYKLTVKPTCHVNSSM
SYKFVMKLLIIRPLTTSNTYSLKRLKSMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNK
LLETLGKAEPFFIRCIRSNAEKKEMLFDENLVLQQLRYTGMLETVRIRRSGYSAKYTFQE
FIDQFQVLLPKNAKASKEDIFAYLSKLKLDKNNCQIGKTKVFMKEAERQILQDTLHKEVI
RKIILLQSWLRMVLERRRFLRTRQAAIVLQACWRSRCVRRALQRNNAAIYIQSAWRRYRE
QKRYLEHKKRICLVQAMVRGYLQRKRFQKMVMEKQKAEEEQRKMQEAQDRENDMKKDEGN
EPTMDQLSVQHESELDQVVEGKDEVPSEQAENLGSSEMTTLPQKNVIEGSEKVTSSREKR
EFRRQRGLEHNELQNKHVQFSFEEAALLRPEEQTSSEEGLENVPEPKESTEQVAVLQKSN
EKEQNANRGKAISDTPLQLPALEVERVDKAVDRVMKIQESQNSQLKVSQSCPERPTNLAL
NLENTLFAPGSFQTPAECWGDKNKRPVQKETKDLDSPTSSQIQRYVDDPGKLKYKREKWK
GKRQSDAGQNDMLSQSLDGRTRADQSPQDPLEKKGTSSSLNDLSALAHAATSQQSPDTIE
EEKGNKKYLLQKKSSDLLPTSDTVVSMQPASQQIDAKYVFFVLFDISVIFDPAEEQILCV
LHNMLFLLFDLRNHTEALIKGLRNEIAREKLKNTVNMYCFSPGQLPILQLRDFLSQKWCH
GNEICCLYFLCRVNIHSINYSYCGLKLLYYEPFLVKXHNLKTXYSAPNGQIHVGYKDLVE
NYQLLVTNLAKKREEKEVKLVLNLFQSLLDEFIRGYTKKEESEQPKLALNVLRILKYLYI
VFASYKLKLHCSCVSRIWRYIWPMEKACLCSVCKLTCHKKCMSKIQSSCTSCGKKNEQDA
EPRHFGVCVSSLTSERNSVPIVMEKLLEHVEMHGLYTEGIYRKSGSANRMKELKQLLQAD
PNSVKLENYPIHTITGILKQWLRELPDPLMTSAQYSDFLRAVELPEKQEQLCAIYSVLEQ
LPQANHDTLERLIFHLVKVALIEDVNRMSPNALAIVFAPCLLRCPDTSDPLTSMKDVSKT
TMCVEMLIKEQIRKYKIKMDEINQLEAAESIAFRRLSLLRQNTLWPVKLGFSSPYEGMLS
KSPQVKGNDSGNSELGSLHEEEEVSEADNREKEILIDRIQSIKEEKEDITYRLPELDQRG
SDEENVDSETSASTESLLEERTGRMDTEVPAKDICTVPSLLQTSSSSLSASLASRRRSSL
TLSKIKVPRRTPVMPTANIKLPPGIFKCTESQGKTSADEESQIVVRRREQPAIRTDKVHS
IYIAQGSAMAHAQELLDEYEPTAKVKRRFSDP
Download sequence
Identical sequences G1N194
ENSMGAP00000005251 ENSMGAP00000005251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]