SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005410 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005410
Domain Number 1 Region: 263-608
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.65e-80
Family p120GAP domain-like 0.0000456
Further Details:      
 
Domain Number 2 Region: 565-707
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-32
Family Pleckstrin-homology domain (PH domain) 0.0065
Further Details:      
 
Domain Number 3 Region: 113-255
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.27e-30
Family Synaptotagmin-like (S variant) 0.0018
Further Details:      
 
Domain Number 4 Region: 7-131
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.4e-29
Family PLC-like (P variant) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005410   Gene: ENSMGAG00000005402   Transcript: ENSMGAT00000006143
Sequence length 732
Comment pep:known_by_projection chromosome:UMD2:17:11697135:11703862:-1 gene:ENSMGAG00000005402 transcript:ENSMGAT00000006143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSTSLYCRLVEGKELPAKDVSGSSDPYCVVKVDNEVVARTATVWRSLNPFWGEEFTLR
LPSGFHSLTIYVLDEDTIGHDDVIGKVSLSHQQISAQLRGIDSWLSLVPVHPDQEVQGEI
HLEVKMPEQGHPRVLRCHLIAARDLAPRDPSGTSDPFVRVSCCGHTQETAVIKKTRFPQW
DEVLEFELAEDEPGDSMLSVEVWDWDIVGKNDFLGQVKICLDASGPMEGWFQLLPFPSSS
EEPGGQLGSLRLTVRLLEDRVLPQHCYQPLIQLLAEPLHSPGQPAASTALAVLEEVTSGD
SRQDVATKLVKIFLAQGLAVPFLDYIITRELTRTTDPNTLFRSNSLASKSVEQFLKAVGL
PYLHAVLKPVVNRIFEEKKYVELDPCKMELSRGRRISFKGSLSEAQVRESSLELLQGYLG
DMVDAIVGSVDKCPLLMRVAFKQLRRRVEERFPSPQHEEVQYFAISGFLFLRFFAPAVLT
PKLFGLREQHAEPRTGRTLLLLAKALQSIGNLGLQPGKESWMAPLNTVLLPSITRVRAFL
DSLIEVDSTQGEGMASVAPFSPSATIKEGFLHAREAEEPSLLPRFAFKKRYFWLSAQALS
YSKSPECQEHSCIPVGHIRAVERVDEGTFPQPHVMQVVAQDGTGQLRTTYIQCKSAPELW
QWLWALRQASSANEAMLPTCHPGTFRTARWTCCLQPNRAAAGCSRTHSAVALDEWSDPLD
PAAAAQSLYGHL
Download sequence
Identical sequences G1N1K9
ENSMGAP00000005410 ENSMGAP00000005410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]