SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006122 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006122
Domain Number 1 Region: 258-557
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.12e-86
Family Pancreatic carboxypeptidases 0.000000000415
Further Details:      
 
Domain Number 2 Region: 685-974
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.97e-64
Family Pancreatic carboxypeptidases 0.0000206
Further Details:      
 
Domain Number 3 Region: 4-195
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.77e-25
Family Pancreatic carboxypeptidases 0.0000203
Further Details:      
 
Domain Number 4 Region: 557-633
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.1e-18
Family Carboxypeptidase regulatory domain 0.0000155
Further Details:      
 
Domain Number 5 Region: 975-1069
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000000392
Family Carboxypeptidase regulatory domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006122   Gene: ENSMGAG00000006112   Transcript: ENSMGAT00000006869
Sequence length 1141
Comment pep:known_by_projection chromosome:UMD2:21:6531020:6549870:1 gene:ENSMGAG00000006112 transcript:ENSMGAT00000006869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPNSRFLLSGNLHGGSVVASYPYDDSPTHKPTGVYSKSADDEVFKYLAKAYASHHPIMRT
GKPNCPGEEGETFPEGITNGAQWYDVEGGMQDYNYVWADCFEITLELSCCKYPLTSELQQ
EWENNRESLLSFIEKVHIGVKGFVRDAVTKAGLENATIVVAGIAHNITAGKYGDYHRLLV
PGTYNVTAVVMGYTPLTRENIEVKEGDATEVDFFLQPTVMAPAPNLTQLTATLAPASTIA
STVVQAEAPSPTSLRQPIQPVDFRHHHFSDMEIFLRRYANEYPNITRLYSAGKSVELREL
YVMEISDNPGVHEAGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVRST
RIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPDQFFQVADPPQPETLAVMSW
LKSYPFVLSANLHGGSLVVNYPYDDDEQGMAIYSKSPDDAVFQQLALSYSKENKKMYQGS
PCKDMYPNEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEVTIELGCVKYPNAEELPKYW
EQNRRSLLQFMKQVHRGVWGFVLDATDGRGILNATISVAEINHPVTTYKDGDYWRLLVQG
TYKITASARGYNPVTKMVAVDSEGAVQVNFTLKRTDAKVEEGNVPVLNTPDTSDPNEKEF
ETLIKDLSAENGVERLLLSSSGKVSPYRYRPYKDLSEFLRGLYLNYPLITNLSSLGQSVE
FRQIWSLEISNKPNQSEPEEPKIRFVAGIHGNAPVGTELLLTLAEFLCMNYKKNAAVTKL
IDRTRIVIVPSLNPDGREIAQERGCTSKIGQTNAHGRDLDTDFTGNYSRYSGTQEPETKA
MENLILKQDFSLSVALDGGSLLVTYPYDKPVQTVENKETLKHLASVYANNHPSMHLGQPG
CPNKSDENIPGGVIRGSEWHSHLGSMKDFSVTFGHCPEITVYTSCCYFPSAGQLPGLWAE
HRRSLLSMLVEVHKGVHGFVQDKSGKAISKAVIVLNEGLRVCTKEGGYFHVLLAPGLHNI
NAIADGYQQKHMQVLVRHDAPSSVFIVFDMENKIFGLPRELVVTVAGASMSALILTACII
WCVCSIKSNRHKDGFHRLRQHHDDYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSK
H
Download sequence
Identical sequences G1N356
ENSMGAP00000006122 ENSMGAP00000006122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]